Columba livia (rock pigeon): 102087186 Help Entry 102087186         CDS       T02912                                  Symbol NPY Name (RefSeq) pro-neuropeptide Y precursor   KO K05232   neuropeptide Y Organism clv  Columba livia (rock pigeon) Pathway clv04080   Neuroactive ligand-receptor interaction clv04920   Adipocytokine signaling pathway Brite KEGG Orthology (KO) [BR:clv00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     102087186 (NPY)  09150 Organismal Systems   09152 Endocrine system    04920 Adipocytokine signaling pathway     102087186 (NPY)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:clv04052]     102087186 (NPY) Cytokines and neuropeptides [BR:clv04052]  Neuropeptides   Neuropeptides (GPCR binding)    102087186 (NPY) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Hormone_3 Motif Other DBs NCBI-GeneID:  102087186 NCBI-ProteinID:  NP_001269740 UniProt:  B9U357 LinkDB All DBs AA seq 97 aa AA seqDB search MQGTVRLWVSVLTFALSLLVCLGTLAEAYPSKPDSPGEDAPAEDMARYYSALRHYINLIT RQRYGKRSSPETLISDLLLRESTKNIPRSRFEEPSMW NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgcagggtaccgtgaggctgtgggtgtcggtgctgactttcgccctgtcgctgctggtc tgcctggggacgctggcagaggcgtacccctccaaaccggacagccccggcgaggacgcc cccgcagaggacatggccagatactactcggcgctgaggcactacatcaacctcatcacc cggcagagatacggaaagagatcaagcccagagacactgatctcagacctcttgttgagg gaaagcacaaaaaatattcctagatccaggtttgaagaaccttcgatgtggtga

DBGET integrated database retrieval system