Corynebacterium matruchotii: HBA49_10605 Help Entry HBA49_10605       CDS       T07153                                  Name (GenBank) mycoredoxin   KO K18917   mycoredoxin [EC:1.20.4.3] Organism cmat  Corynebacterium matruchotii Brite KEGG Orthology (KO) [BR:cmat00001]  09190 Not Included in Pathway or Brite   09191 Unclassified: metabolism    99980 Enzymes with EC numbers     HBA49_10605 Enzymes [BR:cmat01000]  1. Oxidoreductases   1.20  Acting on phosphorus or arsenic in donors    1.20.4  With disulfide as acceptor     1.20.4.3  mycoredoxin      HBA49_10605 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin GST_N_2 GST_N_3 Thioredoxin Thioredoxin_2 Ribosomal_S21e Glrx-like AhpC-TSA Motif Other DBs NCBI-ProteinID:  QIP45904 UniProt:  A0A6H9XFQ4 LinkDB All DBs Position 1900858..1901142 Genome browser AA seq 94 aa AA seqDB search MVFVIPDMTNDLVTLYVTSWCPFCQRLISALDDAAVPYAAIDVDHDAEAARWVESVNNGN RVVPTVLYSDGTHATNPPAKVVARKYARLAATKA NT seq 285 nt NT seq  +upstreamnt  +downstreamnt atggtttttgttatacctgacatgactaatgatcttgttaccttatacgtgacgtcgtgg tgcccattctgccagcgactcataagcgcgcttgacgacgctgccgtgccgtatgctgcc attgatgttgaccatgatgccgaggccgcccggtgggtggaatccgtcaataatggcaat cgggtggtgcccacagtgttgtattcggatgggacgcatgctaccaatccgccggcgaag gtggtggcacggaaatacgcccgcctggcagccaccaaggcgtga

DBGET integrated database retrieval system