Cavia porcellus (domestic guinea pig): 100135622 Help Entry 100135622         CDS       T07777                                  Symbol Sod1 Name (RefSeq) superoxide dismutase [Cu-Zn]   KO K04565   superoxide dismutase, Cu-Zn family [EC:1.15.1.1] Organism cpoc  Cavia porcellus (domestic guinea pig) Pathway cpoc04146   Peroxisome cpoc04213   Longevity regulating pathway - multiple species cpoc05012   Parkinson disease cpoc05014   Amyotrophic lateral sclerosis cpoc05016   Huntington disease cpoc05020   Prion disease cpoc05022   Pathways of neurodegeneration - multiple diseases cpoc05208   Chemical carcinogenesis - reactive oxygen species Brite KEGG Orthology (KO) [BR:cpoc00001]  09140 Cellular Processes   09141 Transport and catabolism    04146 Peroxisome     100135622 (Sod1)  09150 Organismal Systems   09149 Aging    04213 Longevity regulating pathway - multiple species     100135622 (Sod1)  09160 Human Diseases   09161 Cancer: overview    05208 Chemical carcinogenesis - reactive oxygen species     100135622 (Sod1)   09164 Neurodegenerative disease    05012 Parkinson disease     100135622 (Sod1)    05014 Amyotrophic lateral sclerosis     100135622 (Sod1)    05016 Huntington disease     100135622 (Sod1)    05020 Prion disease     100135622 (Sod1)    05022 Pathways of neurodegeneration - multiple diseases     100135622 (Sod1) Enzymes [BR:cpoc01000]  1. Oxidoreductases   1.15  Acting on superoxide as acceptor    1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)     1.15.1.1  superoxide dismutase      100135622 (Sod1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Sod_Cu Motif Other DBs NCBI-GeneID:  100135622 NCBI-ProteinID:  XP_003467296 Ensembl:  ENSCPOG00000014223 UniProt:  P33431 LinkDB All DBs Position Unknown AA seq 153 aa AA seqDB search MATKAVCVLKGDGPVQGIIHFEQKANGPVVVKGRITGLVEGKHGFHVHEFGDNTQGCTSA GPHFNPLSKKHGGPQDEERHVGDLGNVTAGADGVANVSIEDSLISLSGANSIIGRTMVVH EKPDDLGKGGNEESTKTGNAGSRLACGVIGIAQ NT seq 462 nt NT seq  +upstreamnt  +downstreamnt atggcgaccaaggccgtgtgcgtgctgaagggcgacggcccggtgcaggggatcatccac ttcgagcagaaggcaaacgggcccgttgtggtaaagggacgcattacgggattggttgaa ggcaagcacggattccatgtccatgagtttggcgataatacacaaggctgtaccagtgca ggtcctcactttaatcctctatccaaaaaacatggtgggccacaggatgaagagaggcat gttggagacctgggcaatgtgactgctggtgcagacggcgtggccaatgtatccatcgag gactctctgatctcactctccggagcaaattccatcattggccgcacaatggtggtccat gaaaaaccagatgacctgggcaagggtggaaatgaagaaagtacaaagacgggaaatgct ggaagtcggctggcttgcggcgtgattgggattgcccagtaa

DBGET integrated database retrieval system