Cavia porcellus (domestic guinea pig): 100735236 Help Entry 100735236         CDS       T07777                                  Name (RefSeq) histone H3.3   KO K11253   histone H3 Organism cpoc  Cavia porcellus (domestic guinea pig) Pathway cpoc04613   Neutrophil extracellular trap formation cpoc05034   Alcoholism cpoc05202   Transcriptional misregulation in cancer cpoc05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:cpoc00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     100735236  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     100735236   09163 Immune disease    05322 Systemic lupus erythematosus     100735236   09165 Substance dependence    05034 Alcoholism     100735236  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:cpoc03036]     100735236   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cpoc04147]     100735236 Chromosome and associated proteins [BR:cpoc03036]  Eukaryotic type   Nucleosome assembly factors    Histones     100735236 Exosome [BR:cpoc04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    100735236 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CENP-T_C PAF CENP-S CBFD_NFYB_HMF TFIID-31kDa Motif Other DBs NCBI-GeneID:  100735236 NCBI-ProteinID:  XP_003462414 Ensembl:  ENSCPOG00000039202 UniProt:  H0V3S0 LinkDB All DBs Position Unknown AA seq 136 aa AA seqDB search MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTE LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTI MPKDIQLARRIRGERA NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggctcgtaccaagcagactgcccgcaaatccaccggtggtaaagcgcccaggaaacaa ctggctacaaaagccgcacgtaagagtgcgccctctactggaggggtgaagaaacctcat cgttacaggcctgggactgtggcacttcgtgaaattaggcgttatcagaagtccactgaa cttctgattcgcaaacttcctttccagcgtctggttcgtgaaattgctcaggacttcaaa acagatctgcgcttccagagcgcagctattggtgctttgcaggaggcaagtgaggcctat ctggttggcctgtttgaagacaccaacctgtgtgccatccatgccaaacgtgtcacaatt atgccaaaagacatccagctagcacgccgcattcgtggagaacgtgcttaa

DBGET integrated database retrieval system