Carlito syrichta (Philippine tarsier): 103255498 Help Entry 103255498         CDS       T07836                                  Symbol IKBKG Name (RefSeq) NF-kappa-B essential modulator   KO K07210   inhibitor of nuclear factor kappa-B kinase subunit gamma Organism csyr  Carlito syrichta (Philippine tarsier) Pathway csyr01523   Antifolate resistance csyr04010   MAPK signaling pathway csyr04014   Ras signaling pathway csyr04062   Chemokine signaling pathway csyr04064   NF-kappa B signaling pathway csyr04151   PI3K-Akt signaling pathway csyr04210   Apoptosis csyr04380   Osteoclast differentiation csyr04620   Toll-like receptor signaling pathway csyr04621   NOD-like receptor signaling pathway csyr04622   RIG-I-like receptor signaling pathway csyr04623   Cytosolic DNA-sensing pathway csyr04625   C-type lectin receptor signaling pathway csyr04657   IL-17 signaling pathway csyr04658   Th1 and Th2 cell differentiation csyr04659   Th17 cell differentiation csyr04660   T cell receptor signaling pathway csyr04662   B cell receptor signaling pathway csyr04668   TNF signaling pathway csyr04920   Adipocytokine signaling pathway csyr04936   Alcoholic liver disease csyr05010   Alzheimer disease csyr05132   Salmonella infection csyr05135   Yersinia infection csyr05142   Chagas disease csyr05145   Toxoplasmosis csyr05160   Hepatitis C csyr05161   Hepatitis B csyr05162   Measles csyr05163   Human cytomegalovirus infection csyr05164   Influenza A csyr05165   Human papillomavirus infection csyr05166   Human T-cell leukemia virus 1 infection csyr05167   Kaposi sarcoma-associated herpesvirus infection csyr05168   Herpes simplex virus 1 infection csyr05169   Epstein-Barr virus infection csyr05170   Human immunodeficiency virus 1 infection csyr05171   Coronavirus disease - COVID-19 csyr05200   Pathways in cancer csyr05203   Viral carcinogenesis csyr05208   Chemical carcinogenesis - reactive oxygen species csyr05212   Pancreatic cancer csyr05215   Prostate cancer csyr05220   Chronic myeloid leukemia csyr05221   Acute myeloid leukemia csyr05222   Small cell lung cancer csyr05235   PD-L1 expression and PD-1 checkpoint pathway in cancer csyr05340   Primary immunodeficiency csyr05417   Lipid and atherosclerosis csyr05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:csyr00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     103255498 (IKBKG)    04014 Ras signaling pathway     103255498 (IKBKG)    04064 NF-kappa B signaling pathway     103255498 (IKBKG)    04668 TNF signaling pathway     103255498 (IKBKG)    04151 PI3K-Akt signaling pathway     103255498 (IKBKG)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     103255498 (IKBKG)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     103255498 (IKBKG)    04621 NOD-like receptor signaling pathway     103255498 (IKBKG)    04622 RIG-I-like receptor signaling pathway     103255498 (IKBKG)    04623 Cytosolic DNA-sensing pathway     103255498 (IKBKG)    04625 C-type lectin receptor signaling pathway     103255498 (IKBKG)    04660 T cell receptor signaling pathway     103255498 (IKBKG)    04658 Th1 and Th2 cell differentiation     103255498 (IKBKG)    04659 Th17 cell differentiation     103255498 (IKBKG)    04657 IL-17 signaling pathway     103255498 (IKBKG)    04662 B cell receptor signaling pathway     103255498 (IKBKG)    04062 Chemokine signaling pathway     103255498 (IKBKG)   09152 Endocrine system    04920 Adipocytokine signaling pathway     103255498 (IKBKG)   09158 Development and regeneration    04380 Osteoclast differentiation     103255498 (IKBKG)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     103255498 (IKBKG)    05208 Chemical carcinogenesis - reactive oxygen species     103255498 (IKBKG)    05203 Viral carcinogenesis     103255498 (IKBKG)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     103255498 (IKBKG)   09162 Cancer: specific types    05212 Pancreatic cancer     103255498 (IKBKG)    05221 Acute myeloid leukemia     103255498 (IKBKG)    05220 Chronic myeloid leukemia     103255498 (IKBKG)    05215 Prostate cancer     103255498 (IKBKG)    05222 Small cell lung cancer     103255498 (IKBKG)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     103255498 (IKBKG)    05170 Human immunodeficiency virus 1 infection     103255498 (IKBKG)    05161 Hepatitis B     103255498 (IKBKG)    05160 Hepatitis C     103255498 (IKBKG)    05171 Coronavirus disease - COVID-19     103255498 (IKBKG)    05164 Influenza A     103255498 (IKBKG)    05162 Measles     103255498 (IKBKG)    05168 Herpes simplex virus 1 infection     103255498 (IKBKG)    05163 Human cytomegalovirus infection     103255498 (IKBKG)    05167 Kaposi sarcoma-associated herpesvirus infection     103255498 (IKBKG)    05169 Epstein-Barr virus infection     103255498 (IKBKG)    05165 Human papillomavirus infection     103255498 (IKBKG)   09171 Infectious disease: bacterial    05132 Salmonella infection     103255498 (IKBKG)    05135 Yersinia infection     103255498 (IKBKG)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     103255498 (IKBKG)    05142 Chagas disease     103255498 (IKBKG)   09163 Immune disease    05340 Primary immunodeficiency     103255498 (IKBKG)   09164 Neurodegenerative disease    05010 Alzheimer disease     103255498 (IKBKG)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     103255498 (IKBKG)    05418 Fluid shear stress and atherosclerosis     103255498 (IKBKG)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     103255498 (IKBKG)   09176 Drug resistance: antineoplastic    01523 Antifolate resistance     103255498 (IKBKG)  09180 Brite Hierarchies   09181 Protein families: metabolism    01001 Protein kinases [BR:csyr01001]     103255498 (IKBKG) Protein kinases [BR:csyr01001]  Serine/threonine kinases: Other   IKK family [OT]    103255498 (IKBKG) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  CC2-LZ NEMO zf_C2H2_10 LLC1 Nairovirus_NSm Motif Other DBs NCBI-GeneID:  103255498 NCBI-ProteinID:  XP_008051662 Ensembl:  ENSTSYG00000034417 UniProt:  A0A1U7TFB0 LinkDB All DBs Position Unknown AA seq 419 aa AA seqDB search MSRHPWKSRPCEMVQPSGGPAADQDDLGEESSPGKPAMLHLPSEQGTPDTLQRSLEENQE LRDAIRQSNQMLRERCEELRRFQDSQREEREFLVCKFQEARKLVERLSLEKLDLKRQREQ ALQEVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKERQALEGRARAASEQ ARQLESEREALQQQHSVQVDQLRMQSQSMEAALRMERQAASEEKRKLAQLQVAYHQLFQD YDNHIKNSMGSSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPV LKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSKLKASCQESARIEDMRKRH IEVPQLPLPPAPAHQSFHPTLPSQRRSPPEEPPDFCCPKCQYQAPDMDTLQIHVMECIE NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt atgagcaggcacccctggaagagccggccgtgtgagatggtgcagcccagcggtggccca gcagcggatcaggacgatctgggcgaagagtcttctccggggaagccggccatgttacat ctgccttcagagcagggcacgccggacacccttcagcgctctctggaggagaaccaagag ctccgagatgccatccgacagagcaaccagatgctgcgggagcgctgcgaggagctgcgg cgtttccaggacagccagcgagaggagagggagttcctcgtatgcaagttccaggaggcc aggaagctggtggagcgactcagcctggagaagctggacctgaagcggcagagggagcag gccctgcaggaagtggagcacctgaagcggtgccagcagcagatggccgaggacaaggcc tccgtcaaggcccaggtgacatccttgctgggggagctccaggaaagccagagtcgcttg gaggctgccacgaaggaacgacaggccttggagggccgggcccgagctgccagcgagcag gccaggcagctggagagtgagcgcgaggcactgcagcagcagcacagtgtgcaggtggac cagctgcgcatgcagagccagagcatggaggccgccctgcgcatggagcgccaggccgcc tccgaggagaagcgaaagctggcccagctgcaggtggcatatcaccagctcttccaggac tacgacaaccacatcaagaacagcatggggagcagtgagcgcaagagaggcatgcaactg gaggatctgaagcagcagctccagcaggcagaggaggccctggtggccaagcaggaagtg attgacaagctgaaagaggaggccgagcagcacaagatcgtgatggagactgttcccgtc ctcaaggcccaggcggatatctacaaggcagacttccaggctgagaggcaggcccgggag aagctggctgagaagaaggagcttctgcaggagcagctggagcagttgcagagggagtac agcaagttgaaagccagctgccaggagtcggccaggattgaggacatgaggaagcggcat atagaggtcccccagctccccctgcccccggccccagcccaccagtccttccacccgacc ctgcccagccagaggagaagcccccccgaggagccgcctgacttctgctgtcccaagtgc cagtaccaggctcctgacatggataccctgcagatacatgtcatggagtgcatcgagtag

DBGET integrated database retrieval system