Cheilinus undulatus (humphead wrasse): 121508630 Help Entry 121508630         CDS       T07473                                  Name (RefSeq) interleukin-8-like   KO K10030   interleukin 8 Organism cud  Cheilinus undulatus (humphead wrasse) Pathway cud04060   Cytokine-cytokine receptor interaction cud04218   Cellular senescence cud04620   Toll-like receptor signaling pathway cud04621   NOD-like receptor signaling pathway cud04622   RIG-I-like receptor signaling pathway cud05132   Salmonella infection Brite KEGG Orthology (KO) [BR:cud00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     121508630  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     121508630  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     121508630    04621 NOD-like receptor signaling pathway     121508630    04622 RIG-I-like receptor signaling pathway     121508630  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     121508630  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:cud04052]     121508630    00536 Glycosaminoglycan binding proteins [BR:cud00536]     121508630 Cytokines and neuropeptides [BR:cud04052]  Cytokines   Chemokines    121508630 Glycosaminoglycan binding proteins [BR:cud00536]  Heparan sulfate / Heparin   Chemokines    121508630 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 DUF2615 zf-H2C2_5 Motif Other DBs NCBI-GeneID:  121508630 NCBI-ProteinID:  XP_041641546 LinkDB All DBs Position 4:29009564..29011122 Genome browser AA seq 97 aa AA seqDB search MSTEMSGISIVALLVFLAVPEGISLGNQGFDRCQCITKEKRPIGRHIRTVQVIQPSSHCQ DMEIVATLKKDGKRVCLDPNVPWVKKTLERQQTQQTP NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgagcacagaaatgtctggcatcagtattgtggcacttctggttttcctggctgtccct gagggtatcagcctcggcaatcaggggtttgatcgatgtcaatgcatcaccaaggagaag aggcccattggacggcatataagaacggtgcaggtgatccagccaagctcacattgccaa gacatggagattgttgccacgctcaaaaaggatgggaaaagggtttgtctggaccctaat gtaccttgggtcaaaaagacacttgaaaggcaacagactcagcagacgccttga

DBGET integrated database retrieval system