Chromobacterium violaceum: CV_1127 Help Entry CV_1127           CDS       T00147                                  Symbol secB Name (GenBank) protein-export protein   KO K03071   preprotein translocase subunit SecB Organism cvi  Chromobacterium violaceum Pathway cvi02024   Quorum sensing cvi03060   Protein export cvi03070   Bacterial secretion system Brite KEGG Orthology (KO) [BR:cvi00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     CV_1127 (secB)  09130 Environmental Information Processing   09131 Membrane transport    03070 Bacterial secretion system     CV_1127 (secB)  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     CV_1127 (secB)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:cvi03110]     CV_1127 (secB)   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:cvi02044]     CV_1127 (secB) Chaperones and folding catalysts [BR:cvi03110]  Other chaperones and cochaperones   SecB    CV_1127 (secB) Secretion system [BR:cvi02044]  Sec (secretion) system   Prokaryotic Sec-SRP core components    CV_1127 (secB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  SecB Motif Other DBs NCBI-ProteinID:  AAQ58802 LNCC_Brazil:  CV1127 UniProt:  Q7NYZ5 LinkDB All DBs Position 1181080..1181532 Genome browser AA seq 150 aa AA seqDB search MSEQQELQPAFSIEKIYVKDISLEVPNAPQVFLEQAQPEIDMQLASAGQQLDDGFFEVTL TVTVTAKLPEKTMFLCEVAQAGIFQIRNIPGEDLDPILGVACPNILFPYARETVSSVVNR AGFPPVLLAPINFEALYMQQRAQQAEAGNA NT seq 453 nt NT seq  +upstreamnt  +downstreamnt atgagcgaacaacaagagctgcaaccggcgttttccatcgaaaaaatctatgtgaaggac atctcgctggaggtgccgaacgcgccccaggtgttcctggaacaagctcagccggaaatc gacatgcagctggccagcgccggccagcagctggacgacggcttcttcgaagtgaccctg accgtcaccgtgaccgccaagctgccggaaaaaaccatgttcctgtgcgaagtggcccag gcaggcatcttccagatccgcaacatcccgggcgaagacctggacccgatcctgggcgtg gcttgcccgaacatcctgttcccgtacgcgcgcgagacggtgtccagcgtggtgaaccgc gccggcttcccgccggtgctgctggcgccgatcaacttcgaagcgctgtacatgcagcag cgcgcgcagcaagccgaagccggcaacgcctga

DBGET integrated database retrieval system