Diaphorobacter sp. HDW4A: G7047_07990 Help Entry G7047_07990       CDS       T06499                                  Name (GenBank) DNA polymerase III subunit chi   KO K02339   DNA polymerase III subunit chi [EC:2.7.7.7] Organism dih  Diaphorobacter sp. HDW4A Pathway dih03030   DNA replication dih03430   Mismatch repair dih03440   Homologous recombination Brite KEGG Orthology (KO) [BR:dih00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     G7047_07990    03430 Mismatch repair     G7047_07990    03440 Homologous recombination     G7047_07990  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:dih03032]     G7047_07990    03400 DNA repair and recombination proteins [BR:dih03400]     G7047_07990 Enzymes [BR:dih01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.7  Nucleotidyltransferases     2.7.7.7  DNA-directed DNA polymerase      G7047_07990 DNA replication proteins [BR:dih03032]  Prokaryotic type   DNA Replication Elongation Factors    Elongation factors (bacterial)     DNA polymerase III holoenzyme      G7047_07990 DNA repair and recombination proteins [BR:dih03400]  Prokaryotic type   SSBR (single strand breaks repair)    MMR (mismatch excision repair)     DNA polymerase III holoenzyme      G7047_07990 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DNA_pol3_chi Uma2 Motif Other DBs NCBI-ProteinID:  QIL79854 UniProt:  A0A6G8CLZ8 LinkDB All DBs Position 1779051..1779488 Genome browser AA seq 145 aa AA seqDB search MTEVAFHFNAPDKLAYACRFARKAFKRGLRVVVTGSAADLQALDRMMWALGPTDFVAHAL ADGDPEVVAVSPVLLAVDPQSVAPRDMLLNLGGQIPPGFDQFEKVIEVVSSSDEQDRQLA RTRWRQYAADGYEIVRHDLVLKENA NT seq 438 nt NT seq  +upstreamnt  +downstreamnt atgacggaagtagcttttcatttcaacgcgccggacaagctggcctacgcctgccgcttt gcgcgcaaggcgttcaagcgcggcctgcgcgtagtggtaactggaagtgccgcggatttg caggcgcttgatcgcatgatgtgggcgttgggccccacggattttgtggcgcatgcgctt gccgacggcgatccagaggtggtcgcggtgtcgcccgtgctgcttgctgtggatccgcag tcggttgcgccgcgtgacatgctgctcaatctgggtggtcagattccgcccgggtttgat cagttcgagaaagtgatcgaggtcgtgagttcgagcgatgaacaagatcgccagctcgcg cgcacgcgctggcgtcagtacgctgcagacggttacgagatcgttcgccatgatctggtt ttgaaagaaaatgcctga

DBGET integrated database retrieval system