Delphinapterus leucas (beluga whale): 111172168 Help Entry 111172168         CDS       T05885                                  Symbol SOD1 Name (RefSeq) superoxide dismutase [Cu-Zn]   KO K04565   superoxide dismutase, Cu-Zn family [EC:1.15.1.1] Organism dle  Delphinapterus leucas (beluga whale) Pathway dle04146   Peroxisome dle04213   Longevity regulating pathway - multiple species dle05012   Parkinson disease dle05014   Amyotrophic lateral sclerosis dle05016   Huntington disease dle05020   Prion disease dle05022   Pathways of neurodegeneration - multiple diseases dle05208   Chemical carcinogenesis - reactive oxygen species Brite KEGG Orthology (KO) [BR:dle00001]  09140 Cellular Processes   09141 Transport and catabolism    04146 Peroxisome     111172168 (SOD1)  09150 Organismal Systems   09149 Aging    04213 Longevity regulating pathway - multiple species     111172168 (SOD1)  09160 Human Diseases   09161 Cancer: overview    05208 Chemical carcinogenesis - reactive oxygen species     111172168 (SOD1)   09164 Neurodegenerative disease    05012 Parkinson disease     111172168 (SOD1)    05014 Amyotrophic lateral sclerosis     111172168 (SOD1)    05016 Huntington disease     111172168 (SOD1)    05020 Prion disease     111172168 (SOD1)    05022 Pathways of neurodegeneration - multiple diseases     111172168 (SOD1) Enzymes [BR:dle01000]  1. Oxidoreductases   1.15  Acting on superoxide as acceptor    1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)     1.15.1.1  superoxide dismutase      111172168 (SOD1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Sod_Cu Motif Other DBs NCBI-GeneID:  111172168 NCBI-ProteinID:  XP_022424139 UniProt:  A0A2Y9MPB1 LinkDB All DBs Position Unknown AA seq 153 aa AA seqDB search MATKAVCVLKGDGPVQGTIHFEQKEDGTVVVSGSITGLTEGDHGFHVHQFGDNTQGCTSA GPHFNPLSKKHGGPEDEERHVGDLGNVKADQNGVAEVYIEDSIISLCGDHSIIGRTMVVH EKPDDLGRGGNEESTKTGNAGSRLACGVIGIAQ NT seq 462 nt NT seq  +upstreamnt  +downstreamnt atggcgacgaaggccgtgtgcgtgctgaagggcgacggcccggtgcagggtaccatccac ttcgaacaaaaggaagatgggacggtcgtggtatcgggatccattacaggattgactgaa ggcgatcatggattccatgtccatcaatttggagataatacacaaggctgtaccagtgca ggtcctcactttaaccctctatccaaaaaacacggtgggccagaggatgaagagaggcat gttggagacctgggcaatgtgaaggctgaccaaaatggtgtggccgaagtgtatattgaa gattctataatctcactctgtggagaccattccatcattggccgcacaatggtggtccat gaaaaaccagatgacttgggcagaggtggaaatgaagaaagtacaaagacaggaaacgct ggaagtcgtttggcctgtggtgtaattgggatcgcccaataa

DBGET integrated database retrieval system