Delphinapterus leucas (beluga whale): 111180543 Help Entry 111180543         CDS       T05885                                  Name (RefSeq) cytochrome c   KO K08738   cytochrome c Organism dle  Delphinapterus leucas (beluga whale) Pathway dle00190   Oxidative phosphorylation dle01100   Metabolic pathways dle01524   Platinum drug resistance dle04115   p53 signaling pathway dle04210   Apoptosis dle04215   Apoptosis - multiple species dle04932   Non-alcoholic fatty liver disease dle05010   Alzheimer disease dle05012   Parkinson disease dle05014   Amyotrophic lateral sclerosis dle05016   Huntington disease dle05017   Spinocerebellar ataxia dle05020   Prion disease dle05022   Pathways of neurodegeneration - multiple diseases dle05132   Salmonella infection dle05134   Legionellosis dle05145   Toxoplasmosis dle05152   Tuberculosis dle05160   Hepatitis C dle05161   Hepatitis B dle05162   Measles dle05163   Human cytomegalovirus infection dle05164   Influenza A dle05167   Kaposi sarcoma-associated herpesvirus infection dle05168   Herpes simplex virus 1 infection dle05169   Epstein-Barr virus infection dle05170   Human immunodeficiency virus 1 infection dle05200   Pathways in cancer dle05210   Colorectal cancer dle05222   Small cell lung cancer dle05416   Viral myocarditis dle05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:dle00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     111180543  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     111180543    04215 Apoptosis - multiple species     111180543    04115 p53 signaling pathway     111180543  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     111180543   09162 Cancer: specific types    05210 Colorectal cancer     111180543    05222 Small cell lung cancer     111180543   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     111180543    05161 Hepatitis B     111180543    05160 Hepatitis C     111180543    05164 Influenza A     111180543    05162 Measles     111180543    05168 Herpes simplex virus 1 infection     111180543    05163 Human cytomegalovirus infection     111180543    05167 Kaposi sarcoma-associated herpesvirus infection     111180543    05169 Epstein-Barr virus infection     111180543   09171 Infectious disease: bacterial    05132 Salmonella infection     111180543    05134 Legionellosis     111180543    05152 Tuberculosis     111180543   09174 Infectious disease: parasitic    05145 Toxoplasmosis     111180543   09164 Neurodegenerative disease    05010 Alzheimer disease     111180543    05012 Parkinson disease     111180543    05014 Amyotrophic lateral sclerosis     111180543    05016 Huntington disease     111180543    05017 Spinocerebellar ataxia     111180543    05020 Prion disease     111180543    05022 Pathways of neurodegeneration - multiple diseases     111180543   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     111180543    05416 Viral myocarditis     111180543   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     111180543   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     111180543 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Cytochrom_C Cytochrome_CBB3 Cytochrom_C550 CCP_MauG Motif Other DBs NCBI-GeneID:  111180543 NCBI-ProteinID:  XP_022440632 UniProt:  A0A2Y9PBF7 LinkDB All DBs Position Unknown AA seq 105 aa AA seqDB search MCDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAVGFSYTDANKNKGITW GEETLMEYLENPKKYIPGTKMIFAGIKKKSERADLIAYLKKATNE NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atgtgtgatgttgagaagggcaagaagatttttgttcagaagtgtgcccagtgccatact gtggaaaagggaggcaagcacaagactgggccaaatctccatggtctgtttgggcgaaag acaggtcaggctgtcggattctcttacacagatgccaacaagaacaaaggcatcacctgg ggagaggagacgctgatggagtatttggagaatcccaagaagtacatccctggaacaaaa atgatcttcgctggcattaagaagaagtcagaaagggcagacttgatagcttatctcaaa aaagctactaatgagtaa

DBGET integrated database retrieval system