Danaus plexippus (monarch butterfly): KGM_207205A Help Entry KGM_207205A       CDS       T04344                                  Name (GenBank) histone H2B protein   KO K11252   histone H2B Organism dpl  Danaus plexippus (monarch butterfly) Brite KEGG Orthology (KO) [BR:dpl00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:dpl03036]     KGM_207205A   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:dpl04147]     KGM_207205A Chromosome and associated proteins [BR:dpl03036]  Eukaryotic type   Nucleosome assembly factors    Histones     KGM_207205A Exosome [BR:dpl04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    KGM_207205A BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CBFD_NFYB_HMF TFIID_20kDa DUF1931 Motif Other DBs NCBI-ProteinID:  OWR51927 UniProt:  A0A212FE15 LinkDB All DBs Position Unknown AA seq 66 aa AA seqDB search MSIMNSFVNDIFERIAAEASRLAHYNKRSTITSREVQTSVRLLLPGELAKHAVSEGTKAV TKYTSS NT seq 200 nt NT seq  +upstreamnt  +downstreamnt atgtctatcatgaactccttcgtgaacgatatattcgaacgcatcgccgccgaagcatca cgtctcgcgcactacaacaagagatccaccattacatcgagggaggttcagacgtccgtg agactgttgctgcccggcgagttggccaagcacgccgtcagtgaagggaccaaagccgtc actaagtacaccagttccaa

DBGET integrated database retrieval system