Dreissena polymorpha (Zebra mussel): 127846722 Help Entry 127846722         CDS       T08834                                  Name (RefSeq) elongin-B-like   KO K03873   elongin-B Organism dpol  Dreissena polymorpha (Zebra mussel) Pathway dpol04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:dpol00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     127846722  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:dpol04121]     127846722    03400 DNA repair and recombination proteins [BR:dpol03400]     127846722 Ubiquitin system [BR:dpol04121]  Ubiquitin ligases (E3)   Multi subunit Ring-finger type E3    Cul2 complex     Adoptor protein      127846722    Cul5 complex      127846722 DNA repair and recombination proteins [BR:dpol03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      127846722 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Rad60-SLD Sporozoite_P67 Motif Other DBs NCBI-GeneID:  127846722 NCBI-ProteinID:  XP_052234181 LinkDB All DBs Position 1:117154030..117175548 Genome browser AA seq 120 aa AA seqDB search MDVFLMIRRKKVTIFTDAKESTTVLEVKKIVEGIVKQKPEDQRLYKDDQPLDDNKTLGDC GFTSLTARAQAPATIGLSFRMEDGEYEPLEVTALSSPPELPDVMKPQDSPSTHAQEQTAS NT seq 363 nt NT seq  +upstreamnt  +downstreamnt atggatgtgtttttaatgattcggcgcaagaaagtcaccatatttacagatgcaaaagag tccaccacagtgttagaagtaaagaaaattgtagaaggtattgtcaaacagaaacctgaa gaccagcgtctgtataaagatgatcagccattagatgacaacaaaacccttggagactgc ggcttcacgagtctgactgccagagcacaggcccccgccactataggcttgtccttcaga atggaagatggcgaatatgagccgttggaggtgacggccctgtccagtccacctgagctg cccgatgtgatgaagccccaggactcgccctccacacacgcccaggagcagaccgcctca tag

DBGET integrated database retrieval system