Dryobates pubescens (Downy woodpecker): 104305351 Help Entry 104305351         CDS       T08526                                  Name (RefSeq) cystatin-like   KO K13899   cystatin-C Organism dpub  Dryobates pubescens (Downy woodpecker) Brite KEGG Orthology (KO) [BR:dpub00001]  09180 Brite Hierarchies   09181 Protein families: metabolism    01002 Peptidases and inhibitors [BR:dpub01002]     104305351   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:dpub04147]     104305351 Peptidases and inhibitors [BR:dpub01002]  Peptidase inhibitors   Family I25: cystatin family    104305351 Exosome [BR:dpub04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    104305351 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Cystatin Motif Other DBs NCBI-GeneID:  104305351 NCBI-ProteinID:  XP_009904502 LinkDB All DBs Position Unknown AA seq 80 aa AA seqDB search MRPVDFLGERAGFELEGVVAGIKYIMEVEIARTTCEKPAADLQDCAFPDSPQLAKHTVCK FVVYTVPWLKKTELLKRECQ NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgaggcctgtggatttccttggagaaagagcaggcttcgagctcgagggggttgtggct ggaatcaagtacatcatggaagtggagattgccaggacaacctgtgaaaagccagcagct gatctgcaggactgcgctttccctgactcaccccagctggccaagcacactgtctgcaag tttgtagtgtacactgttccttggctgaagaaaacggaactgctgaagagggagtgccag taa

DBGET integrated database retrieval system