Desmodus rotundus (common vampire bat): 112302944 Help Entry 112302944         CDS       T05907                                  Symbol IL1B Name (RefSeq) interleukin-1 beta   KO K04519   interleukin 1 beta Organism dro  Desmodus rotundus (common vampire bat) Pathway dro01523   Antifolate resistance dro04010   MAPK signaling pathway dro04060   Cytokine-cytokine receptor interaction dro04064   NF-kappa B signaling pathway dro04217   Necroptosis dro04380   Osteoclast differentiation dro04620   Toll-like receptor signaling pathway dro04621   NOD-like receptor signaling pathway dro04623   Cytosolic DNA-sensing pathway dro04625   C-type lectin receptor signaling pathway dro04640   Hematopoietic cell lineage dro04657   IL-17 signaling pathway dro04659   Th17 cell differentiation dro04668   TNF signaling pathway dro04750   Inflammatory mediator regulation of TRP channels dro04932   Non-alcoholic fatty liver disease dro04933   AGE-RAGE signaling pathway in diabetic complications dro04936   Alcoholic liver disease dro04940   Type I diabetes mellitus dro05010   Alzheimer disease dro05020   Prion disease dro05022   Pathways of neurodegeneration - multiple diseases dro05132   Salmonella infection dro05133   Pertussis dro05134   Legionellosis dro05135   Yersinia infection dro05140   Leishmaniasis dro05142   Chagas disease dro05143   African trypanosomiasis dro05144   Malaria dro05146   Amoebiasis dro05152   Tuberculosis dro05162   Measles dro05163   Human cytomegalovirus infection dro05164   Influenza A dro05168   Herpes simplex virus 1 infection dro05171   Coronavirus disease - COVID-19 dro05321   Inflammatory bowel disease dro05323   Rheumatoid arthritis dro05332   Graft-versus-host disease dro05417   Lipid and atherosclerosis dro05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:dro00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     112302944 (IL1B)    04064 NF-kappa B signaling pathway     112302944 (IL1B)    04668 TNF signaling pathway     112302944 (IL1B)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     112302944 (IL1B)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     112302944 (IL1B)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     112302944 (IL1B)    04620 Toll-like receptor signaling pathway     112302944 (IL1B)    04621 NOD-like receptor signaling pathway     112302944 (IL1B)    04623 Cytosolic DNA-sensing pathway     112302944 (IL1B)    04625 C-type lectin receptor signaling pathway     112302944 (IL1B)    04659 Th17 cell differentiation     112302944 (IL1B)    04657 IL-17 signaling pathway     112302944 (IL1B)   09157 Sensory system    04750 Inflammatory mediator regulation of TRP channels     112302944 (IL1B)   09158 Development and regeneration    04380 Osteoclast differentiation     112302944 (IL1B)  09160 Human Diseases   09172 Infectious disease: viral    05171 Coronavirus disease - COVID-19     112302944 (IL1B)    05164 Influenza A     112302944 (IL1B)    05162 Measles     112302944 (IL1B)    05168 Herpes simplex virus 1 infection     112302944 (IL1B)    05163 Human cytomegalovirus infection     112302944 (IL1B)   09171 Infectious disease: bacterial    05132 Salmonella infection     112302944 (IL1B)    05135 Yersinia infection     112302944 (IL1B)    05133 Pertussis     112302944 (IL1B)    05134 Legionellosis     112302944 (IL1B)    05152 Tuberculosis     112302944 (IL1B)   09174 Infectious disease: parasitic    05146 Amoebiasis     112302944 (IL1B)    05144 Malaria     112302944 (IL1B)    05140 Leishmaniasis     112302944 (IL1B)    05142 Chagas disease     112302944 (IL1B)    05143 African trypanosomiasis     112302944 (IL1B)   09163 Immune disease    05323 Rheumatoid arthritis     112302944 (IL1B)    05321 Inflammatory bowel disease     112302944 (IL1B)    05332 Graft-versus-host disease     112302944 (IL1B)   09164 Neurodegenerative disease    05010 Alzheimer disease     112302944 (IL1B)    05020 Prion disease     112302944 (IL1B)    05022 Pathways of neurodegeneration - multiple diseases     112302944 (IL1B)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     112302944 (IL1B)    05418 Fluid shear stress and atherosclerosis     112302944 (IL1B)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     112302944 (IL1B)    04936 Alcoholic liver disease     112302944 (IL1B)    04932 Non-alcoholic fatty liver disease     112302944 (IL1B)    04933 AGE-RAGE signaling pathway in diabetic complications     112302944 (IL1B)   09176 Drug resistance: antineoplastic    01523 Antifolate resistance     112302944 (IL1B)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:dro04052]     112302944 (IL1B)    00536 Glycosaminoglycan binding proteins [BR:dro00536]     112302944 (IL1B) Cytokines and neuropeptides [BR:dro04052]  Cytokines   Interleukins    112302944 (IL1B) Glycosaminoglycan binding proteins [BR:dro00536]  Heparan sulfate / Heparin   Cytokines    112302944 (IL1B) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL1_propep IL1 SUN Motif Other DBs NCBI-GeneID:  112302944 NCBI-ProteinID:  XP_024414191 LinkDB All DBs Position Unknown AA seq 267 aa AA seqDB search MAAVPELTSEMMAYYSDNENDLFFEADGPQQTKCSFQDLDLSSLGDGSIQLKVSHQLYNS SFRQVASVVVAVEKLRKVPIVCSQEFQDDDLRSLFFFIFEEEPIDSMWDDTYVCDAPLQS LNCRLHDINQKSLVLSGPHELQALHLTRQNMNQEVVFCMRFVPGEENNKIPVALGIKEKD LYLSCMTKDGKPTLQLETLDPKAQSKKKMEKRFVFNKTEMMGKVEFESAMYPNWYISTSQ AEQTPVFLGNIRGGQDITDFTLEILSA NT seq 804 nt NT seq  +upstreamnt  +downstreamnt atggcagcagtacctgaactcaccagtgaaatgatggcttactacagtgacaatgagaat gacctgttctttgaggctgatggcccccaacagactaagtgctcctttcaagacctggac ctcagctctctgggagatgggagcatccagctgaaagtctcccaccagctctacaactcg agtttcaggcaggttgcgtcggtcgtggttgctgtggagaagctgaggaaagtgcccatt gtctgctcacaggaattccaggatgatgacctgaggagcctctttttcttcatctttgaa gaagaacccattgacagcatgtgggatgacacttacgtgtgcgatgcacccctacaatcg ctgaactgcagactccatgacataaaccaaaaatccctggtgctgtctggaccacatgag ctgcaggctcttcacctcactagacagaatatgaaccaagaagtggtgttctgcatgaga tttgtgccaggagaagaaaataataagatacctgtggccttgggcatcaaggaaaaagac ctgtacctgtcttgcatgacaaaggatgggaagcccaccctgcagctggagacattagac cccaaagctcagtcaaagaagaagatggaaaagcgatttgtcttcaacaagacagaaatg atgggcaaggtagaatttgagtctgccatgtatcccaactggtacatcagcacctcgcaa gcagaacagacgcccgtcttcctaggaaatattagaggtggccaggatataactgacttc accttggaaatcctgtctgcctga

DBGET integrated database retrieval system