Klebsiella aerogenes KCTC 2190: EAE_09760 Help Entry EAE_09760         CDS       T01529                                  Name (GenBank) DNA polymerase III subunit chi   KO K02339   DNA polymerase III subunit chi [EC:2.7.7.7] Organism eae  Klebsiella aerogenes KCTC 2190 Pathway eae03030   DNA replication eae03430   Mismatch repair eae03440   Homologous recombination Brite KEGG Orthology (KO) [BR:eae00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     EAE_09760    03430 Mismatch repair     EAE_09760    03440 Homologous recombination     EAE_09760  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:eae03032]     EAE_09760    03400 DNA repair and recombination proteins [BR:eae03400]     EAE_09760 Enzymes [BR:eae01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.7  Nucleotidyltransferases     2.7.7.7  DNA-directed DNA polymerase      EAE_09760 DNA replication proteins [BR:eae03032]  Prokaryotic type   DNA Replication Elongation Factors    Elongation factors (bacterial)     DNA polymerase III holoenzyme      EAE_09760 DNA repair and recombination proteins [BR:eae03400]  Prokaryotic type   SSBR (single strand breaks repair)    MMR (mismatch excision repair)     DNA polymerase III holoenzyme      EAE_09760 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DNA_pol3_chi Motif Other DBs NCBI-ProteinID:  AEG96870 UniProt:  A0A0H3FVL2 LinkDB All DBs Position complement(2064837..2065280) Genome browser AA seq 147 aa AA seqDB search MKNATFYLLDNDTIVDELSAVEQLVCEIAAERWRNGKRVLIACEDEQQAIRLDEALWTRP PESFVPHNLAGEGPRGGAPVEIAWPQKRNSSPRDILISLRLNFADFATAFTEVIDFVPYE DSLKQLARERYKAYRMAGFNLNTATWK NT seq 444 nt NT seq  +upstreamnt  +downstreamnt atgaaaaacgcaacgttctatcttctggacaatgacaccatcgtcgacgagctcagcgcc gtcgagcagctggtgtgtgaaattgccgcagaacgttggcgcaacggcaaacgcgtcctg atcgcctgtgaagatgaacagcaggctattcgccttgacgaagcgctgtggacgcggccg ccggagagctttgtgccgcataacctggcgggcgaaggcccgagaggcggcgcgccggta gaaattgcctggccgcaaaagcgcaacagcagcccgcgggatattcttatcagcctgcgg ctaaactttgcagattttgccaccgctttcacagaagtgatagactttgtcccttacgaa gattctctgaaacaactggcgcgcgaacgctataaagcgtaccgcatggctggtttcaac ctgaacacggcaacctggaaataa

DBGET integrated database retrieval system