Equus caballus (horse): 100033955 Help Entry 100033955         CDS       T01058                                  Symbol FGF2 Name (RefSeq) fibroblast growth factor 2   KO K18497   fibroblast growth factor 2 Organism ecb  Equus caballus (horse) Pathway ecb01521   EGFR tyrosine kinase inhibitor resistance ecb04010   MAPK signaling pathway ecb04014   Ras signaling pathway ecb04015   Rap1 signaling pathway ecb04020   Calcium signaling pathway ecb04151   PI3K-Akt signaling pathway ecb04550   Signaling pathways regulating pluripotency of stem cells ecb04810   Regulation of actin cytoskeleton ecb05167   Kaposi sarcoma-associated herpesvirus infection ecb05200   Pathways in cancer ecb05205   Proteoglycans in cancer ecb05207   Chemical carcinogenesis - receptor activation ecb05218   Melanoma ecb05224   Breast cancer ecb05226   Gastric cancer Brite KEGG Orthology (KO) [BR:ecb00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     100033955 (FGF2)    04014 Ras signaling pathway     100033955 (FGF2)    04015 Rap1 signaling pathway     100033955 (FGF2)    04020 Calcium signaling pathway     100033955 (FGF2)    04151 PI3K-Akt signaling pathway     100033955 (FGF2)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04550 Signaling pathways regulating pluripotency of stem cells     100033955 (FGF2)   09142 Cell motility    04810 Regulation of actin cytoskeleton     100033955 (FGF2)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100033955 (FGF2)    05205 Proteoglycans in cancer     100033955 (FGF2)    05207 Chemical carcinogenesis - receptor activation     100033955 (FGF2)   09162 Cancer: specific types    05226 Gastric cancer     100033955 (FGF2)    05218 Melanoma     100033955 (FGF2)    05224 Breast cancer     100033955 (FGF2)   09172 Infectious disease: viral    05167 Kaposi sarcoma-associated herpesvirus infection     100033955 (FGF2)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     100033955 (FGF2)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ecb04052]     100033955 (FGF2)    00536 Glycosaminoglycan binding proteins [BR:ecb00536]     100033955 (FGF2) Cytokines and neuropeptides [BR:ecb04052]  Cytokines   Growth factors (RTK binding)    100033955 (FGF2) Glycosaminoglycan binding proteins [BR:ecb00536]  Heparan sulfate / Heparin   Growth factors/receptors    100033955 (FGF2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FGF Fascin IL1 Motif Other DBs NCBI-GeneID:  100033955 NCBI-ProteinID:  NP_001182150 UniProt:  E0AEV7 LinkDB All DBs Position 2:complement(105637419..105690405) Genome browser AA seq 155 aa AA seqDB search MAAGSITTLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHI KLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKY SSWYVALKRTGQYKLGPKTGPGQKAILFLPMSAKS NT seq 468 nt NT seq  +upstreamnt  +downstreamnt atggcagccgggagcatcaccacgctgcccgccctgcccgaggacggcggcagcggcgcc ttcccgcccggccacttcaaggaccccaagcggctctactgcaaaaacgggggcttcttc ctgcgcatccaccccgacggccgagtggacggggtccgggagaagagcgaccctcacatc aaactacaacttcaagcagaagagagaggggttgtgtctatcaaaggagtgtgtgcgaac cgttatcttgctatgaaggaagatggaaggttactggcttctaaatgtgttacggacgag tgtttcttttttgaacgattggaatctaataactacaatacttaccggtcaaggaaatac tccagttggtatgtggccctgaaacgaacggggcagtataaacttggacccaaaacagga cctggacagaaagctatactttttcttccaatgtctgctaagagctga

DBGET integrated database retrieval system