Equus caballus (horse): 100034015 Help Entry 100034015         CDS       T01058                                  Symbol TMSB4X Name (RefSeq) thymosin beta-4   KO K05764   thymosin, beta 4 Organism ecb  Equus caballus (horse) Pathway ecb04810   Regulation of actin cytoskeleton Brite KEGG Orthology (KO) [BR:ecb00001]  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     100034015 (TMSB4X)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:ecb04812]     100034015 (TMSB4X) Cytoskeleton proteins [BR:ecb04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Thymosin      100034015 (TMSB4X) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Thymosin WH2 Qua1 Motif Other DBs NCBI-GeneID:  100034015 NCBI-ProteinID:  NP_001157420 Ensembl:  ENSECAG00000009190 UniProt:  P62327 LinkDB All DBs Position X:9656701..9658836 Genome browser AA seq 44 aa AA seqDB search MSDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES NT seq 135 nt NT seq  +upstreamnt  +downstreamnt atgtctgacaaacccgatatggctgagattgagaaattcgataagtccaaattgaagaag acggaaacgcaagagaaaaatccactgccttcaaaagaaacgattgaacaggagaagcaa gcaggcgaatcgtaa

DBGET integrated database retrieval system