Equus caballus (horse): 100034199 Help Entry 100034199         CDS       T01058                                  Symbol IL5 Name (RefSeq) interleukin-5 precursor   KO K05428   interleukin 5 Organism ecb  Equus caballus (horse) Pathway ecb04060   Cytokine-cytokine receptor interaction ecb04630   JAK-STAT signaling pathway ecb04640   Hematopoietic cell lineage ecb04657   IL-17 signaling pathway ecb04658   Th1 and Th2 cell differentiation ecb04660   T cell receptor signaling pathway ecb04664   Fc epsilon RI signaling pathway ecb04672   Intestinal immune network for IgA production ecb05200   Pathways in cancer ecb05310   Asthma ecb05320   Autoimmune thyroid disease ecb05321   Inflammatory bowel disease ecb05330   Allograft rejection Brite KEGG Orthology (KO) [BR:ecb00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     100034199 (IL5)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     100034199 (IL5)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     100034199 (IL5)    04660 T cell receptor signaling pathway     100034199 (IL5)    04658 Th1 and Th2 cell differentiation     100034199 (IL5)    04657 IL-17 signaling pathway     100034199 (IL5)    04664 Fc epsilon RI signaling pathway     100034199 (IL5)    04672 Intestinal immune network for IgA production     100034199 (IL5)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100034199 (IL5)   09163 Immune disease    05310 Asthma     100034199 (IL5)    05320 Autoimmune thyroid disease     100034199 (IL5)    05321 Inflammatory bowel disease     100034199 (IL5)    05330 Allograft rejection     100034199 (IL5)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ecb04052]     100034199 (IL5)    00536 Glycosaminoglycan binding proteins [BR:ecb00536]     100034199 (IL5) Cytokines and neuropeptides [BR:ecb04052]  Cytokines   Interleukins    100034199 (IL5) Glycosaminoglycan binding proteins [BR:ecb00536]  Heparan sulfate / Heparin   Cytokines    100034199 (IL5) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL5 Motif Other DBs NCBI-GeneID:  100034199 NCBI-ProteinID:  NP_001075968 Ensembl:  ENSECAG00000016648 UniProt:  O02699 LinkDB All DBs Position 14:42325088..42326664 Genome browser AA seq 134 aa AA seqDB search MRMLLHLSVLALGAAYVCALAVESPMNRLVAETLTLLSTHRTLLIGDGNLMIPTPEHKNH QLCIEEVFQGIDTLKNQTVQGDAVAKLFQNLSLIKGYIDLQKKKCGGERWRVKQFLDYLQ EFLGVINTEWTIEG NT seq 405 nt NT seq  +upstreamnt  +downstreamnt atgaggatgcttctgcatttgagtgtgctagctcttggagctgcctacgtctgtgccctt gctgtagaaagtcccatgaacagactagtggcagagaccttgacactgctctccactcat cgaactctgctgataggcgatgggaacctgatgattcctactcctgaacataaaaatcac caactctgcattgaagaagtctttcagggaatagacacattgaagaatcaaactgtccaa ggggatgctgtggccaaactattccaaaacttgtctttaataaaaggatacatagacctc caaaaaaaaaagtgtggaggagaaagatggagagtgaaacaattcctagactacctgcag gagtttcttggtgtaataaacactgagtggacaatagaaggctga

DBGET integrated database retrieval system