Equus caballus (horse): 100052818 Help Entry 100052818         CDS       T01058                                  Symbol IFN-ALPHA2 Name (RefSeq) interferon alpha-2 precursor   KO K05414   interferon alpha Organism ecb  Equus caballus (horse) Pathway ecb04060   Cytokine-cytokine receptor interaction ecb04151   PI3K-Akt signaling pathway ecb04217   Necroptosis ecb04620   Toll-like receptor signaling pathway ecb04621   NOD-like receptor signaling pathway ecb04622   RIG-I-like receptor signaling pathway ecb04623   Cytosolic DNA-sensing pathway ecb04630   JAK-STAT signaling pathway ecb04650   Natural killer cell mediated cytotoxicity ecb04936   Alcoholic liver disease ecb05152   Tuberculosis ecb05160   Hepatitis C ecb05161   Hepatitis B ecb05162   Measles ecb05163   Human cytomegalovirus infection ecb05164   Influenza A ecb05165   Human papillomavirus infection ecb05167   Kaposi sarcoma-associated herpesvirus infection ecb05168   Herpes simplex virus 1 infection ecb05169   Epstein-Barr virus infection ecb05170   Human immunodeficiency virus 1 infection ecb05171   Coronavirus disease - COVID-19 ecb05200   Pathways in cancer ecb05320   Autoimmune thyroid disease ecb05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:ecb00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     100052818 (IFN-ALPHA2)    04151 PI3K-Akt signaling pathway     100052818 (IFN-ALPHA2)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     100052818 (IFN-ALPHA2)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     100052818 (IFN-ALPHA2)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     100052818 (IFN-ALPHA2)    04621 NOD-like receptor signaling pathway     100052818 (IFN-ALPHA2)    04622 RIG-I-like receptor signaling pathway     100052818 (IFN-ALPHA2)    04623 Cytosolic DNA-sensing pathway     100052818 (IFN-ALPHA2)    04650 Natural killer cell mediated cytotoxicity     100052818 (IFN-ALPHA2)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100052818 (IFN-ALPHA2)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     100052818 (IFN-ALPHA2)    05161 Hepatitis B     100052818 (IFN-ALPHA2)    05160 Hepatitis C     100052818 (IFN-ALPHA2)    05171 Coronavirus disease - COVID-19     100052818 (IFN-ALPHA2)    05164 Influenza A     100052818 (IFN-ALPHA2)    05162 Measles     100052818 (IFN-ALPHA2)    05168 Herpes simplex virus 1 infection     100052818 (IFN-ALPHA2)    05163 Human cytomegalovirus infection     100052818 (IFN-ALPHA2)    05167 Kaposi sarcoma-associated herpesvirus infection     100052818 (IFN-ALPHA2)    05169 Epstein-Barr virus infection     100052818 (IFN-ALPHA2)    05165 Human papillomavirus infection     100052818 (IFN-ALPHA2)   09171 Infectious disease: bacterial    05152 Tuberculosis     100052818 (IFN-ALPHA2)   09163 Immune disease    05320 Autoimmune thyroid disease     100052818 (IFN-ALPHA2)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     100052818 (IFN-ALPHA2)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     100052818 (IFN-ALPHA2)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ecb04052]     100052818 (IFN-ALPHA2) Cytokines and neuropeptides [BR:ecb04052]  Cytokines   Interferons    100052818 (IFN-ALPHA2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Interferon Motif Other DBs NCBI-GeneID:  100052818 NCBI-ProteinID:  NP_001108009 Ensembl:  ENSECAG00000006690 UniProt:  A0A3Q2KSE2 LinkDB All DBs Position 23:complement(39842309..39842863) Genome browser AA seq 184 aa AA seqDB search MALPFSLLMALVVLSCHSSCSLGCDLPHTHSLGNTRVLMLLGQMRRISPFSCLKDRNDFG FPQEVFDGNQFRKAQAISAVHETIQQIFHLFSTDGSSAAWDESLLDKLYTGLYQQLTELE ACLSQEVGVEETPLMNEDSLLAVRRYFQRIALYLQEKKYSPCAWEIVRAEIMRCFSSSTN LQQS NT seq 555 nt NT seq  +upstreamnt  +downstreamnt atggctctaccattttccttactgatggccctggtggtgctcagctgccactccagctgc tctctgggatgtgacctgcctcacacccatagcctgggcaacacaagggtcttgatgctc ctgggacaaatgaggagaatctcccccttctcctgcctgaaggacagaaatgactttgga ttcccccaggaggtgtttgacggcaaccagttccggaaggctcaagccatctccgcggtc catgagacgatccaacagatcttccacctcttcagcacagacggctcgtctgctgcctgg gacgagagcctcctagacaaactctacactggactctatcagcagctgactgagctggaa gcctgtctgagccaggaggtgggggtggaagagacgcccctgatgaacgaggactccctg ctggctgtgaggagatacttccaaagaatcgctctctatctgcaagagaagaaatacagc ccttgtgcctgggagatcgtcagagcagaaatcatgagatgcttctcttcatccacaaac ttgcagcagagttaa

DBGET integrated database retrieval system