Equus caballus (horse): 100053022 Help Entry 100053022         CDS       T01058                                  Symbol IFNA1 Name (RefSeq) interferon alpha-1 precursor   KO K05414   interferon alpha Organism ecb  Equus caballus (horse) Pathway ecb04060   Cytokine-cytokine receptor interaction ecb04151   PI3K-Akt signaling pathway ecb04217   Necroptosis ecb04620   Toll-like receptor signaling pathway ecb04621   NOD-like receptor signaling pathway ecb04622   RIG-I-like receptor signaling pathway ecb04623   Cytosolic DNA-sensing pathway ecb04630   JAK-STAT signaling pathway ecb04650   Natural killer cell mediated cytotoxicity ecb04936   Alcoholic liver disease ecb05152   Tuberculosis ecb05160   Hepatitis C ecb05161   Hepatitis B ecb05162   Measles ecb05163   Human cytomegalovirus infection ecb05164   Influenza A ecb05165   Human papillomavirus infection ecb05167   Kaposi sarcoma-associated herpesvirus infection ecb05168   Herpes simplex virus 1 infection ecb05169   Epstein-Barr virus infection ecb05170   Human immunodeficiency virus 1 infection ecb05171   Coronavirus disease - COVID-19 ecb05200   Pathways in cancer ecb05320   Autoimmune thyroid disease ecb05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:ecb00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     100053022 (IFNA1)    04151 PI3K-Akt signaling pathway     100053022 (IFNA1)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     100053022 (IFNA1)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     100053022 (IFNA1)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     100053022 (IFNA1)    04621 NOD-like receptor signaling pathway     100053022 (IFNA1)    04622 RIG-I-like receptor signaling pathway     100053022 (IFNA1)    04623 Cytosolic DNA-sensing pathway     100053022 (IFNA1)    04650 Natural killer cell mediated cytotoxicity     100053022 (IFNA1)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100053022 (IFNA1)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     100053022 (IFNA1)    05161 Hepatitis B     100053022 (IFNA1)    05160 Hepatitis C     100053022 (IFNA1)    05171 Coronavirus disease - COVID-19     100053022 (IFNA1)    05164 Influenza A     100053022 (IFNA1)    05162 Measles     100053022 (IFNA1)    05168 Herpes simplex virus 1 infection     100053022 (IFNA1)    05163 Human cytomegalovirus infection     100053022 (IFNA1)    05167 Kaposi sarcoma-associated herpesvirus infection     100053022 (IFNA1)    05169 Epstein-Barr virus infection     100053022 (IFNA1)    05165 Human papillomavirus infection     100053022 (IFNA1)   09171 Infectious disease: bacterial    05152 Tuberculosis     100053022 (IFNA1)   09163 Immune disease    05320 Autoimmune thyroid disease     100053022 (IFNA1)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     100053022 (IFNA1)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     100053022 (IFNA1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ecb04052]     100053022 (IFNA1) Cytokines and neuropeptides [BR:ecb04052]  Cytokines   Interferons    100053022 (IFNA1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Interferon Motif Other DBs NCBI-GeneID:  100053022 NCBI-ProteinID:  NP_001092911 Ensembl:  ENSECAG00000003168 UniProt:  P05005 LinkDB All DBs Position 23:40018456..40019010 Genome browser AA seq 184 aa AA seqDB search MALPVSLLMALVVLSCHSSCSLGCDLPHTHSLGNTRVLMLLGQMRRISPFSCLKDRNDFG FPQEVFDGNQFRKPQAISAVHETIQQIFHLFSTDGSSAAWDESLLDKLYTGLYQQLTELE ACLSQEVGVEETPLMNEDSLLAVRRYFQRIALYLQEKKYSPCAWEIVRAEIMRSFSSSTN LPQS NT seq 555 nt NT seq  +upstreamnt  +downstreamnt atggctctgcctgtttccttactgatggccctggtggtgctcagctgccactccagctgc tctctgggatgtgacctgcctcacacccatagcctgggcaacacaagggtcttgatgctc ctgggacaaatgaggagaatctcccccttctcctgcctgaaggacagaaatgactttgga ttcccccaggaggtgtttgacggcaaccagttccggaagcctcaagccatctctgcggtc catgagacgatccaacagatcttccacctcttcagcacagacggctcgtctgctgcctgg gacgagagcctcctagacaagctctacactggactctatcagcagctgactgagctggaa gcctgtctgagccaggaggtgggggtggaagagacgcccctgatgaacgaggactccctg ctggctgtgaggagatacttccaaagaatcgctctctatctgcaagagaagaaatacagc ccttgtgcctgggagatcgtcagagcagaaatcatgagatccttctcttcatccacaaac ttgccgcagagttaa

DBGET integrated database retrieval system