Equus caballus (horse): 100053597 Help Entry 100053597         CDS       T01058                                  Symbol BCL2L1 Name (RefSeq) bcl-2-like protein 1 isoform X1   KO K04570   Bcl-2-like 1 (apoptosis regulator Bcl-X) Organism ecb  Equus caballus (horse) Pathway ecb01521   EGFR tyrosine kinase inhibitor resistance ecb01524   Platinum drug resistance ecb04014   Ras signaling pathway ecb04064   NF-kappa B signaling pathway ecb04115   p53 signaling pathway ecb04137   Mitophagy - animal ecb04140   Autophagy - animal ecb04151   PI3K-Akt signaling pathway ecb04210   Apoptosis ecb04215   Apoptosis - multiple species ecb04621   NOD-like receptor signaling pathway ecb04630   JAK-STAT signaling pathway ecb05012   Parkinson disease ecb05014   Amyotrophic lateral sclerosis ecb05022   Pathways of neurodegeneration - multiple diseases ecb05145   Toxoplasmosis ecb05162   Measles ecb05166   Human T-cell leukemia virus 1 infection ecb05168   Herpes simplex virus 1 infection ecb05170   Human immunodeficiency virus 1 infection ecb05200   Pathways in cancer ecb05202   Transcriptional misregulation in cancer ecb05212   Pancreatic cancer ecb05220   Chronic myeloid leukemia ecb05222   Small cell lung cancer ecb05225   Hepatocellular carcinoma ecb05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:ecb00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     100053597 (BCL2L1)    04630 JAK-STAT signaling pathway     100053597 (BCL2L1)    04064 NF-kappa B signaling pathway     100053597 (BCL2L1)    04151 PI3K-Akt signaling pathway     100053597 (BCL2L1)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     100053597 (BCL2L1)    04137 Mitophagy - animal     100053597 (BCL2L1)   09143 Cell growth and death    04210 Apoptosis     100053597 (BCL2L1)    04215 Apoptosis - multiple species     100053597 (BCL2L1)    04115 p53 signaling pathway     100053597 (BCL2L1)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     100053597 (BCL2L1)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100053597 (BCL2L1)    05202 Transcriptional misregulation in cancer     100053597 (BCL2L1)   09162 Cancer: specific types    05212 Pancreatic cancer     100053597 (BCL2L1)    05225 Hepatocellular carcinoma     100053597 (BCL2L1)    05220 Chronic myeloid leukemia     100053597 (BCL2L1)    05222 Small cell lung cancer     100053597 (BCL2L1)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     100053597 (BCL2L1)    05170 Human immunodeficiency virus 1 infection     100053597 (BCL2L1)    05162 Measles     100053597 (BCL2L1)    05168 Herpes simplex virus 1 infection     100053597 (BCL2L1)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     100053597 (BCL2L1)   09164 Neurodegenerative disease    05012 Parkinson disease     100053597 (BCL2L1)    05014 Amyotrophic lateral sclerosis     100053597 (BCL2L1)    05022 Pathways of neurodegeneration - multiple diseases     100053597 (BCL2L1)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     100053597 (BCL2L1)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     100053597 (BCL2L1)    01524 Platinum drug resistance     100053597 (BCL2L1)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:ecb01009]     100053597 (BCL2L1)   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:ecb03036]     100053597 (BCL2L1)   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:ecb02000]     100053597 (BCL2L1) Protein phosphatases and associated proteins [BR:ecb01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Protein phosphatase-1     PP1-interacting proteins (PIPs)      100053597 (BCL2L1) Chromosome and associated proteins [BR:ecb03036]  Eukaryotic type   Centrosome formation proteins    Other centriole associated proteins     100053597 (BCL2L1) Transporters [BR:ecb02000]  Other transporters   Pores ion channels [TC:1]    100053597 (BCL2L1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bcl-2 BH4 Bcl-2_3 Motif Other DBs NCBI-GeneID:  100053597 NCBI-ProteinID:  XP_005604607 Ensembl:  ENSECAG00000017223 VGNC:  15791 UniProt:  A0A9L0SSI5 LinkDB All DBs Position 22:complement(23332619..23377387) Genome browser AA seq 245 aa AA seqDB search MSQSNRELVVDFLSYKLSQKGYNWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLA DSPTGNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAY QSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIATWMATYLNDHLEP WIQENGGWKETALGTFCYFVSSLMRLSGQGGALQLAPSYSAFWADSRAPLGTRGFSLALQ EMPLQ NT seq 738 nt NT seq  +upstreamnt  +downstreamnt atgtctcagagcaaccgggagctggtggttgactttctctcctacaagctttcccagaaa ggatacaactggagtcagtttagtgacgtggaagagaacagaactgaggccccagaaggg actgaatcagagatggagacccccagtgccatcaatggcaacccatcctggcacctggcg gacagccccacggggaatggagccactggccacagcagcagcttggatgcccgggaagtg atccccatggcagcagtgaagcaagcgctgagggaggcaggcgatgagtttgaactgagg taccggcgggcattcagcgacctgacatcccagctccacatcaccccagggacagcatat cagagctttgagcaggtagtgaatgaactcttccgggatggggtgaactggggtcgcatt gtggcctttttctccttcggtggggcactgtgcgtggaaagcgtagacaaggagatgcag gtattggtgagtcggatcgcaacctggatggccacttacctgaatgaccacctagagcct tggatccaagagaacggcggctggaaagaaactgctttggggaccttctgctacttcgtt tcatccctgatgagactctcaggccaaggcggagccttacagctagctccaagctacagt gctttttgggcagactccagagctcccctcggaactagaggtttttctctcgctcttcag gaaatgccattgcaatga

DBGET integrated database retrieval system