Equus caballus (horse): 100054253 Help Entry 100054253         CDS       T01058                                  Name (RefSeq) LOW QUALITY PROTEIN: histone H4   KO K11254   histone H4 Organism ecb  Equus caballus (horse) Pathway ecb04613   Neutrophil extracellular trap formation ecb05034   Alcoholism ecb05203   Viral carcinogenesis ecb05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:ecb00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     100054253  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     100054253   09163 Immune disease    05322 Systemic lupus erythematosus     100054253   09165 Substance dependence    05034 Alcoholism     100054253  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:ecb03036]     100054253 Chromosome and associated proteins [BR:ecb03036]  Eukaryotic type   Nucleosome assembly factors    Histones     100054253 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CENP-T_C TAF Histone CENP-S CBFD_NFYB_HMF TFIID-31kDa Bromo_TP UPF0137 Motif Other DBs NCBI-GeneID:  100054253 NCBI-ProteinID:  XP_014595304 LinkDB All DBs Position 5:43765737..43766745 Genome browser AA seq 104 aa AA seqDB search MSGRGKGGKXGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVL KVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG NT seq 315 nt NT seq  +upstreamnt  +downstreamnt atgtctggcagaggaaagggtgggaagnnggggttaggcaaggggggcgctaagcggcac cgcaaagtcttgagagacaacatccaaggcatcaccaagcccgccatccggcgtcttgct cggcgtgggggagtcaagcggatctcgggcctcatttacgaggagacccggggtgtgttg aaggtgttcctggagaacgtcatccgcgacgcggtcacctacacggagcacgccaagcgc aagacggtcactgccatggacgtggtctacgcgctcaagcgccagggccgcaccctgtac ggcttcggaggctaa

DBGET integrated database retrieval system