KEGG   Equus caballus (horse): 100059469
Entry
100059469         CDS       T01058                                 
Symbol
NRAS
Name
(RefSeq) GTPase NRas
  KO
K07828  GTPase NRas
Organism
ecb  Equus caballus (horse)
Pathway
ecb01521  EGFR tyrosine kinase inhibitor resistance
ecb01522  Endocrine resistance
ecb04010  MAPK signaling pathway
ecb04012  ErbB signaling pathway
ecb04014  Ras signaling pathway
ecb04015  Rap1 signaling pathway
ecb04062  Chemokine signaling pathway
ecb04068  FoxO signaling pathway
ecb04071  Sphingolipid signaling pathway
ecb04072  Phospholipase D signaling pathway
ecb04137  Mitophagy - animal
ecb04140  Autophagy - animal
ecb04150  mTOR signaling pathway
ecb04151  PI3K-Akt signaling pathway
ecb04210  Apoptosis
ecb04211  Longevity regulating pathway
ecb04213  Longevity regulating pathway - multiple species
ecb04218  Cellular senescence
ecb04360  Axon guidance
ecb04370  VEGF signaling pathway
ecb04371  Apelin signaling pathway
ecb04540  Gap junction
ecb04550  Signaling pathways regulating pluripotency of stem cells
ecb04625  C-type lectin receptor signaling pathway
ecb04650  Natural killer cell mediated cytotoxicity
ecb04660  T cell receptor signaling pathway
ecb04662  B cell receptor signaling pathway
ecb04664  Fc epsilon RI signaling pathway
ecb04714  Thermogenesis
ecb04720  Long-term potentiation
ecb04722  Neurotrophin signaling pathway
ecb04725  Cholinergic synapse
ecb04726  Serotonergic synapse
ecb04730  Long-term depression
ecb04810  Regulation of actin cytoskeleton
ecb04910  Insulin signaling pathway
ecb04912  GnRH signaling pathway
ecb04915  Estrogen signaling pathway
ecb04916  Melanogenesis
ecb04917  Prolactin signaling pathway
ecb04919  Thyroid hormone signaling pathway
ecb04921  Oxytocin signaling pathway
ecb04926  Relaxin signaling pathway
ecb04929  GnRH secretion
ecb04933  AGE-RAGE signaling pathway in diabetic complications
ecb04935  Growth hormone synthesis, secretion and action
ecb05010  Alzheimer disease
ecb05022  Pathways of neurodegeneration - multiple diseases
ecb05034  Alcoholism
ecb05160  Hepatitis C
ecb05161  Hepatitis B
ecb05163  Human cytomegalovirus infection
ecb05165  Human papillomavirus infection
ecb05166  Human T-cell leukemia virus 1 infection
ecb05167  Kaposi sarcoma-associated herpesvirus infection
ecb05170  Human immunodeficiency virus 1 infection
ecb05200  Pathways in cancer
ecb05203  Viral carcinogenesis
ecb05205  Proteoglycans in cancer
ecb05206  MicroRNAs in cancer
ecb05207  Chemical carcinogenesis - receptor activation
ecb05208  Chemical carcinogenesis - reactive oxygen species
ecb05210  Colorectal cancer
ecb05211  Renal cell carcinoma
ecb05213  Endometrial cancer
ecb05214  Glioma
ecb05215  Prostate cancer
ecb05216  Thyroid cancer
ecb05218  Melanoma
ecb05219  Bladder cancer
ecb05220  Chronic myeloid leukemia
ecb05221  Acute myeloid leukemia
ecb05223  Non-small cell lung cancer
ecb05224  Breast cancer
ecb05225  Hepatocellular carcinoma
ecb05226  Gastric cancer
ecb05230  Central carbon metabolism in cancer
ecb05231  Choline metabolism in cancer
ecb05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ecb05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100059469 (NRAS)
   04012 ErbB signaling pathway
    100059469 (NRAS)
   04014 Ras signaling pathway
    100059469 (NRAS)
   04015 Rap1 signaling pathway
    100059469 (NRAS)
   04370 VEGF signaling pathway
    100059469 (NRAS)
   04371 Apelin signaling pathway
    100059469 (NRAS)
   04068 FoxO signaling pathway
    100059469 (NRAS)
   04072 Phospholipase D signaling pathway
    100059469 (NRAS)
   04071 Sphingolipid signaling pathway
    100059469 (NRAS)
   04151 PI3K-Akt signaling pathway
    100059469 (NRAS)
   04150 mTOR signaling pathway
    100059469 (NRAS)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100059469 (NRAS)
   04137 Mitophagy - animal
    100059469 (NRAS)
  09143 Cell growth and death
   04210 Apoptosis
    100059469 (NRAS)
   04218 Cellular senescence
    100059469 (NRAS)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100059469 (NRAS)
   04550 Signaling pathways regulating pluripotency of stem cells
    100059469 (NRAS)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100059469 (NRAS)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    100059469 (NRAS)
   04650 Natural killer cell mediated cytotoxicity
    100059469 (NRAS)
   04660 T cell receptor signaling pathway
    100059469 (NRAS)
   04662 B cell receptor signaling pathway
    100059469 (NRAS)
   04664 Fc epsilon RI signaling pathway
    100059469 (NRAS)
   04062 Chemokine signaling pathway
    100059469 (NRAS)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100059469 (NRAS)
   04929 GnRH secretion
    100059469 (NRAS)
   04912 GnRH signaling pathway
    100059469 (NRAS)
   04915 Estrogen signaling pathway
    100059469 (NRAS)
   04917 Prolactin signaling pathway
    100059469 (NRAS)
   04921 Oxytocin signaling pathway
    100059469 (NRAS)
   04926 Relaxin signaling pathway
    100059469 (NRAS)
   04935 Growth hormone synthesis, secretion and action
    100059469 (NRAS)
   04919 Thyroid hormone signaling pathway
    100059469 (NRAS)
   04916 Melanogenesis
    100059469 (NRAS)
  09156 Nervous system
   04725 Cholinergic synapse
    100059469 (NRAS)
   04726 Serotonergic synapse
    100059469 (NRAS)
   04720 Long-term potentiation
    100059469 (NRAS)
   04730 Long-term depression
    100059469 (NRAS)
   04722 Neurotrophin signaling pathway
    100059469 (NRAS)
  09158 Development and regeneration
   04360 Axon guidance
    100059469 (NRAS)
  09149 Aging
   04211 Longevity regulating pathway
    100059469 (NRAS)
   04213 Longevity regulating pathway - multiple species
    100059469 (NRAS)
  09159 Environmental adaptation
   04714 Thermogenesis
    100059469 (NRAS)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100059469 (NRAS)
   05206 MicroRNAs in cancer
    100059469 (NRAS)
   05205 Proteoglycans in cancer
    100059469 (NRAS)
   05207 Chemical carcinogenesis - receptor activation
    100059469 (NRAS)
   05208 Chemical carcinogenesis - reactive oxygen species
    100059469 (NRAS)
   05203 Viral carcinogenesis
    100059469 (NRAS)
   05230 Central carbon metabolism in cancer
    100059469 (NRAS)
   05231 Choline metabolism in cancer
    100059469 (NRAS)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100059469 (NRAS)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100059469 (NRAS)
   05225 Hepatocellular carcinoma
    100059469 (NRAS)
   05226 Gastric cancer
    100059469 (NRAS)
   05214 Glioma
    100059469 (NRAS)
   05216 Thyroid cancer
    100059469 (NRAS)
   05221 Acute myeloid leukemia
    100059469 (NRAS)
   05220 Chronic myeloid leukemia
    100059469 (NRAS)
   05218 Melanoma
    100059469 (NRAS)
   05211 Renal cell carcinoma
    100059469 (NRAS)
   05219 Bladder cancer
    100059469 (NRAS)
   05215 Prostate cancer
    100059469 (NRAS)
   05213 Endometrial cancer
    100059469 (NRAS)
   05224 Breast cancer
    100059469 (NRAS)
   05223 Non-small cell lung cancer
    100059469 (NRAS)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100059469 (NRAS)
   05170 Human immunodeficiency virus 1 infection
    100059469 (NRAS)
   05161 Hepatitis B
    100059469 (NRAS)
   05160 Hepatitis C
    100059469 (NRAS)
   05163 Human cytomegalovirus infection
    100059469 (NRAS)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100059469 (NRAS)
   05165 Human papillomavirus infection
    100059469 (NRAS)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100059469 (NRAS)
   05022 Pathways of neurodegeneration - multiple diseases
    100059469 (NRAS)
  09165 Substance dependence
   05034 Alcoholism
    100059469 (NRAS)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100059469 (NRAS)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100059469 (NRAS)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100059469 (NRAS)
   01522 Endocrine resistance
    100059469 (NRAS)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ecb04131]
    100059469 (NRAS)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ecb04147]
    100059469 (NRAS)
   04031 GTP-binding proteins [BR:ecb04031]
    100059469 (NRAS)
Membrane trafficking [BR:ecb04131]
 Exocytosis
  Small GTPases and associated proteins
   Other small GTPases and associated proteins
    100059469 (NRAS)
 Endocytosis
  Macropinocytosis
   Ras GTPases
    100059469 (NRAS)
Exosome [BR:ecb04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100059469 (NRAS)
  Exosomal proteins of other body fluids (saliva and urine)
   100059469 (NRAS)
  Exosomal proteins of breast cancer cells
   100059469 (NRAS)
  Exosomal proteins of colorectal cancer cells
   100059469 (NRAS)
GTP-binding proteins [BR:ecb04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    100059469 (NRAS)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N Septin Ldh_1_N ParA
Other DBs
NCBI-GeneID: 100059469
NCBI-ProteinID: NP_001296099
Ensembl: ENSECAG00000013942
VGNC: 20876
UniProt: K9K3Q7
LinkDB
Position
5:50618942..50626212
AA seq 189 aa
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDL
PTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDGTQG
CMGLPCVVM
NT seq 570 nt   +upstreamnt  +downstreamnt
atgactgagtacaaactggtggtggttggagcaggtggtgttggaaaaagcgcactgaca
atccagctaatccagaaccactttgtagatgaatatgatcccaccatagaggattcttac
cgaaaacaggtggttatagatggtgaaacctgtctgttggacatactggatacagctgga
caagaggagtacagtgccatgagagaccaatacatgaggacaggcgaaggcttcctctgt
gtatttgccatcaataatagcaaatcatttgcagatattaacctctacagggaacagatt
aagcgagtaaaagactcagatgatgtacctatggtgctagtaggaaacaagtgtgatttg
ccaacaaggacagttgacacaaaacaagcccatgaactggctaagagttatgggattccg
ttcatcgaaacctcagccaagaccagacagggtgttgaagatgccttttacacactggtg
agagaaatacgtcagtaccgaatgaaaaaactcaacagcagtgatgatgggactcaaggt
tgcatggggttgccgtgtgtggtgatgtaa

DBGET integrated database retrieval system