Equus caballus (horse): 100059469 Help Entry 100059469         CDS       T01058                                  Symbol NRAS Name (RefSeq) GTPase NRas   KO K07828   GTPase NRas Organism ecb  Equus caballus (horse) Pathway ecb01521   EGFR tyrosine kinase inhibitor resistance ecb01522   Endocrine resistance ecb04010   MAPK signaling pathway ecb04012   ErbB signaling pathway ecb04014   Ras signaling pathway ecb04015   Rap1 signaling pathway ecb04062   Chemokine signaling pathway ecb04068   FoxO signaling pathway ecb04071   Sphingolipid signaling pathway ecb04072   Phospholipase D signaling pathway ecb04137   Mitophagy - animal ecb04140   Autophagy - animal ecb04150   mTOR signaling pathway ecb04151   PI3K-Akt signaling pathway ecb04210   Apoptosis ecb04211   Longevity regulating pathway ecb04213   Longevity regulating pathway - multiple species ecb04218   Cellular senescence ecb04360   Axon guidance ecb04370   VEGF signaling pathway ecb04371   Apelin signaling pathway ecb04540   Gap junction ecb04550   Signaling pathways regulating pluripotency of stem cells ecb04625   C-type lectin receptor signaling pathway ecb04650   Natural killer cell mediated cytotoxicity ecb04660   T cell receptor signaling pathway ecb04662   B cell receptor signaling pathway ecb04664   Fc epsilon RI signaling pathway ecb04714   Thermogenesis ecb04720   Long-term potentiation ecb04722   Neurotrophin signaling pathway ecb04725   Cholinergic synapse ecb04726   Serotonergic synapse ecb04730   Long-term depression ecb04810   Regulation of actin cytoskeleton ecb04910   Insulin signaling pathway ecb04912   GnRH signaling pathway ecb04915   Estrogen signaling pathway ecb04916   Melanogenesis ecb04917   Prolactin signaling pathway ecb04919   Thyroid hormone signaling pathway ecb04921   Oxytocin signaling pathway ecb04926   Relaxin signaling pathway ecb04929   GnRH secretion ecb04933   AGE-RAGE signaling pathway in diabetic complications ecb04935   Growth hormone synthesis, secretion and action ecb05010   Alzheimer disease ecb05022   Pathways of neurodegeneration - multiple diseases ecb05034   Alcoholism ecb05160   Hepatitis C ecb05161   Hepatitis B ecb05163   Human cytomegalovirus infection ecb05165   Human papillomavirus infection ecb05166   Human T-cell leukemia virus 1 infection ecb05167   Kaposi sarcoma-associated herpesvirus infection ecb05170   Human immunodeficiency virus 1 infection ecb05200   Pathways in cancer ecb05203   Viral carcinogenesis ecb05205   Proteoglycans in cancer ecb05206   MicroRNAs in cancer ecb05207   Chemical carcinogenesis - receptor activation ecb05208   Chemical carcinogenesis - reactive oxygen species ecb05210   Colorectal cancer ecb05211   Renal cell carcinoma ecb05213   Endometrial cancer ecb05214   Glioma ecb05215   Prostate cancer ecb05216   Thyroid cancer ecb05218   Melanoma ecb05219   Bladder cancer ecb05220   Chronic myeloid leukemia ecb05221   Acute myeloid leukemia ecb05223   Non-small cell lung cancer ecb05224   Breast cancer ecb05225   Hepatocellular carcinoma ecb05226   Gastric cancer ecb05230   Central carbon metabolism in cancer ecb05231   Choline metabolism in cancer ecb05235   PD-L1 expression and PD-1 checkpoint pathway in cancer ecb05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:ecb00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     100059469 (NRAS)    04012 ErbB signaling pathway     100059469 (NRAS)    04014 Ras signaling pathway     100059469 (NRAS)    04015 Rap1 signaling pathway     100059469 (NRAS)    04370 VEGF signaling pathway     100059469 (NRAS)    04371 Apelin signaling pathway     100059469 (NRAS)    04068 FoxO signaling pathway     100059469 (NRAS)    04072 Phospholipase D signaling pathway     100059469 (NRAS)    04071 Sphingolipid signaling pathway     100059469 (NRAS)    04151 PI3K-Akt signaling pathway     100059469 (NRAS)    04150 mTOR signaling pathway     100059469 (NRAS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     100059469 (NRAS)    04137 Mitophagy - animal     100059469 (NRAS)   09143 Cell growth and death    04210 Apoptosis     100059469 (NRAS)    04218 Cellular senescence     100059469 (NRAS)   09144 Cellular community - eukaryotes    04540 Gap junction     100059469 (NRAS)    04550 Signaling pathways regulating pluripotency of stem cells     100059469 (NRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     100059469 (NRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     100059469 (NRAS)    04650 Natural killer cell mediated cytotoxicity     100059469 (NRAS)    04660 T cell receptor signaling pathway     100059469 (NRAS)    04662 B cell receptor signaling pathway     100059469 (NRAS)    04664 Fc epsilon RI signaling pathway     100059469 (NRAS)    04062 Chemokine signaling pathway     100059469 (NRAS)   09152 Endocrine system    04910 Insulin signaling pathway     100059469 (NRAS)    04929 GnRH secretion     100059469 (NRAS)    04912 GnRH signaling pathway     100059469 (NRAS)    04915 Estrogen signaling pathway     100059469 (NRAS)    04917 Prolactin signaling pathway     100059469 (NRAS)    04921 Oxytocin signaling pathway     100059469 (NRAS)    04926 Relaxin signaling pathway     100059469 (NRAS)    04935 Growth hormone synthesis, secretion and action     100059469 (NRAS)    04919 Thyroid hormone signaling pathway     100059469 (NRAS)    04916 Melanogenesis     100059469 (NRAS)   09156 Nervous system    04725 Cholinergic synapse     100059469 (NRAS)    04726 Serotonergic synapse     100059469 (NRAS)    04720 Long-term potentiation     100059469 (NRAS)    04730 Long-term depression     100059469 (NRAS)    04722 Neurotrophin signaling pathway     100059469 (NRAS)   09158 Development and regeneration    04360 Axon guidance     100059469 (NRAS)   09149 Aging    04211 Longevity regulating pathway     100059469 (NRAS)    04213 Longevity regulating pathway - multiple species     100059469 (NRAS)   09159 Environmental adaptation    04714 Thermogenesis     100059469 (NRAS)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100059469 (NRAS)    05206 MicroRNAs in cancer     100059469 (NRAS)    05205 Proteoglycans in cancer     100059469 (NRAS)    05207 Chemical carcinogenesis - receptor activation     100059469 (NRAS)    05208 Chemical carcinogenesis - reactive oxygen species     100059469 (NRAS)    05203 Viral carcinogenesis     100059469 (NRAS)    05230 Central carbon metabolism in cancer     100059469 (NRAS)    05231 Choline metabolism in cancer     100059469 (NRAS)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     100059469 (NRAS)   09162 Cancer: specific types    05210 Colorectal cancer     100059469 (NRAS)    05225 Hepatocellular carcinoma     100059469 (NRAS)    05226 Gastric cancer     100059469 (NRAS)    05214 Glioma     100059469 (NRAS)    05216 Thyroid cancer     100059469 (NRAS)    05221 Acute myeloid leukemia     100059469 (NRAS)    05220 Chronic myeloid leukemia     100059469 (NRAS)    05218 Melanoma     100059469 (NRAS)    05211 Renal cell carcinoma     100059469 (NRAS)    05219 Bladder cancer     100059469 (NRAS)    05215 Prostate cancer     100059469 (NRAS)    05213 Endometrial cancer     100059469 (NRAS)    05224 Breast cancer     100059469 (NRAS)    05223 Non-small cell lung cancer     100059469 (NRAS)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     100059469 (NRAS)    05170 Human immunodeficiency virus 1 infection     100059469 (NRAS)    05161 Hepatitis B     100059469 (NRAS)    05160 Hepatitis C     100059469 (NRAS)    05163 Human cytomegalovirus infection     100059469 (NRAS)    05167 Kaposi sarcoma-associated herpesvirus infection     100059469 (NRAS)    05165 Human papillomavirus infection     100059469 (NRAS)   09164 Neurodegenerative disease    05010 Alzheimer disease     100059469 (NRAS)    05022 Pathways of neurodegeneration - multiple diseases     100059469 (NRAS)   09165 Substance dependence    05034 Alcoholism     100059469 (NRAS)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     100059469 (NRAS)   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     100059469 (NRAS)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     100059469 (NRAS)    01522 Endocrine resistance     100059469 (NRAS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ecb04131]     100059469 (NRAS)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ecb04147]     100059469 (NRAS)    04031 GTP-binding proteins [BR:ecb04031]     100059469 (NRAS) Membrane trafficking [BR:ecb04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     100059469 (NRAS)  Endocytosis   Macropinocytosis    Ras GTPases     100059469 (NRAS) Exosome [BR:ecb04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    100059469 (NRAS)   Exosomal proteins of other body fluids (saliva and urine)    100059469 (NRAS)   Exosomal proteins of breast cancer cells    100059469 (NRAS)   Exosomal proteins of colorectal cancer cells    100059469 (NRAS) GTP-binding proteins [BR:ecb04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     100059469 (NRAS) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N Septin Ldh_1_N Motif Other DBs NCBI-GeneID:  100059469 NCBI-ProteinID:  NP_001296099 Ensembl:  ENSECAG00000013942 VGNC:  20876 UniProt:  K9K3Q7 LinkDB All DBs Position 5:50618942..50626212 Genome browser AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDL PTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDGTQG CMGLPCVVM NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgactgagtacaaactggtggtggttggagcaggtggtgttggaaaaagcgcactgaca atccagctaatccagaaccactttgtagatgaatatgatcccaccatagaggattcttac cgaaaacaggtggttatagatggtgaaacctgtctgttggacatactggatacagctgga caagaggagtacagtgccatgagagaccaatacatgaggacaggcgaaggcttcctctgt gtatttgccatcaataatagcaaatcatttgcagatattaacctctacagggaacagatt aagcgagtaaaagactcagatgatgtacctatggtgctagtaggaaacaagtgtgatttg ccaacaaggacagttgacacaaaacaagcccatgaactggctaagagttatgggattccg ttcatcgaaacctcagccaagaccagacagggtgttgaagatgccttttacacactggtg agagaaatacgtcagtaccgaatgaaaaaactcaacagcagtgatgatgggactcaaggt tgcatggggttgccgtgtgtggtgatgtaa

DBGET integrated database retrieval system