Equus caballus (horse): 100061874 Help Entry 100061874         CDS       T01058                                  Symbol PPP3R1 Name (RefSeq) calcineurin subunit B type 1   KO K06268   serine/threonine-protein phosphatase 2B regulatory subunit Organism ecb  Equus caballus (horse) Pathway ecb04010   MAPK signaling pathway ecb04020   Calcium signaling pathway ecb04022   cGMP-PKG signaling pathway ecb04114   Oocyte meiosis ecb04218   Cellular senescence ecb04310   Wnt signaling pathway ecb04360   Axon guidance ecb04370   VEGF signaling pathway ecb04380   Osteoclast differentiation ecb04625   C-type lectin receptor signaling pathway ecb04650   Natural killer cell mediated cytotoxicity ecb04658   Th1 and Th2 cell differentiation ecb04659   Th17 cell differentiation ecb04660   T cell receptor signaling pathway ecb04662   B cell receptor signaling pathway ecb04720   Long-term potentiation ecb04724   Glutamatergic synapse ecb04921   Oxytocin signaling pathway ecb04922   Glucagon signaling pathway ecb04924   Renin secretion ecb05010   Alzheimer disease ecb05014   Amyotrophic lateral sclerosis ecb05020   Prion disease ecb05022   Pathways of neurodegeneration - multiple diseases ecb05031   Amphetamine addiction ecb05152   Tuberculosis ecb05163   Human cytomegalovirus infection ecb05166   Human T-cell leukemia virus 1 infection ecb05167   Kaposi sarcoma-associated herpesvirus infection ecb05170   Human immunodeficiency virus 1 infection ecb05235   PD-L1 expression and PD-1 checkpoint pathway in cancer ecb05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:ecb00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     100061874 (PPP3R1)    04310 Wnt signaling pathway     100061874 (PPP3R1)    04370 VEGF signaling pathway     100061874 (PPP3R1)    04020 Calcium signaling pathway     100061874 (PPP3R1)    04022 cGMP-PKG signaling pathway     100061874 (PPP3R1)  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     100061874 (PPP3R1)    04218 Cellular senescence     100061874 (PPP3R1)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     100061874 (PPP3R1)    04650 Natural killer cell mediated cytotoxicity     100061874 (PPP3R1)    04660 T cell receptor signaling pathway     100061874 (PPP3R1)    04658 Th1 and Th2 cell differentiation     100061874 (PPP3R1)    04659 Th17 cell differentiation     100061874 (PPP3R1)    04662 B cell receptor signaling pathway     100061874 (PPP3R1)   09152 Endocrine system    04922 Glucagon signaling pathway     100061874 (PPP3R1)    04921 Oxytocin signaling pathway     100061874 (PPP3R1)    04924 Renin secretion     100061874 (PPP3R1)   09156 Nervous system    04724 Glutamatergic synapse     100061874 (PPP3R1)    04720 Long-term potentiation     100061874 (PPP3R1)   09158 Development and regeneration    04360 Axon guidance     100061874 (PPP3R1)    04380 Osteoclast differentiation     100061874 (PPP3R1)  09160 Human Diseases   09161 Cancer: overview    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     100061874 (PPP3R1)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     100061874 (PPP3R1)    05170 Human immunodeficiency virus 1 infection     100061874 (PPP3R1)    05163 Human cytomegalovirus infection     100061874 (PPP3R1)    05167 Kaposi sarcoma-associated herpesvirus infection     100061874 (PPP3R1)   09171 Infectious disease: bacterial    05152 Tuberculosis     100061874 (PPP3R1)   09164 Neurodegenerative disease    05010 Alzheimer disease     100061874 (PPP3R1)    05014 Amyotrophic lateral sclerosis     100061874 (PPP3R1)    05020 Prion disease     100061874 (PPP3R1)    05022 Pathways of neurodegeneration - multiple diseases     100061874 (PPP3R1)   09165 Substance dependence    05031 Amphetamine addiction     100061874 (PPP3R1)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     100061874 (PPP3R1)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:ecb01009]     100061874 (PPP3R1) Protein phosphatases and associated proteins [BR:ecb01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      100061874 (PPP3R1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_5 EF-hand_8 EF-hand_4 SPARC_Ca_bdg EF-hand_9 Motif Other DBs NCBI-GeneID:  100061874 NCBI-ProteinID:  NP_001296274 Ensembl:  ENSECAG00000009627 VGNC:  51388 LinkDB All DBs Position 15:34924742..34991618 Genome browser AA seq 160 aa AA seqDB search MCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVIDIFDTDGNGEV DFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMVGNNLKDTQLQ QIVDKTIINADKDGDGRISFEEFCAVVGGLDIHKKMVVDV NT seq 483 nt NT seq  +upstreamnt  +downstreamnt atgtgctcacactttgatgctgatgaaattaaaaggctaggaaagaggtttaagaagctt gatttggacaattctggttctttgagtgtggaagaattcatgtctctgcctgagttacaa cagaatcctttagtacaacgagtaatagatatattcgacacagacgggaatggagaagta gactttaaagaattcattgagggggtctctcagttcagtgtcaaaggagataaggaacag aagttgaggtttgctttccgtatctatgacatggataaagatggctatatttccaatggg gaactcttccaggtgctgaagatgatggtggggaacaatctgaaagatacacagttacag caaattgtagacaaaaccataataaatgcagataaagatggagatggaagaatatccttt gaagaattctgtgctgttgtaggtggcctagatatccacaaaaagatggtggtagatgtg tga

DBGET integrated database retrieval system