Equus caballus (horse): 100070422 Help Entry 100070422         CDS       T01058                                  Name (RefSeq) calmodulin-like protein 3   KO K02183   calmodulin Organism ecb  Equus caballus (horse) Pathway ecb04014   Ras signaling pathway ecb04015   Rap1 signaling pathway ecb04020   Calcium signaling pathway ecb04022   cGMP-PKG signaling pathway ecb04024   cAMP signaling pathway ecb04070   Phosphatidylinositol signaling system ecb04114   Oocyte meiosis ecb04218   Cellular senescence ecb04261   Adrenergic signaling in cardiomyocytes ecb04270   Vascular smooth muscle contraction ecb04371   Apelin signaling pathway ecb04625   C-type lectin receptor signaling pathway ecb04713   Circadian entrainment ecb04720   Long-term potentiation ecb04722   Neurotrophin signaling pathway ecb04728   Dopaminergic synapse ecb04740   Olfactory transduction ecb04744   Phototransduction ecb04750   Inflammatory mediator regulation of TRP channels ecb04910   Insulin signaling pathway ecb04912   GnRH signaling pathway ecb04915   Estrogen signaling pathway ecb04916   Melanogenesis ecb04921   Oxytocin signaling pathway ecb04922   Glucagon signaling pathway ecb04924   Renin secretion ecb04925   Aldosterone synthesis and secretion ecb04970   Salivary secretion ecb04971   Gastric acid secretion ecb05010   Alzheimer disease ecb05012   Parkinson disease ecb05022   Pathways of neurodegeneration - multiple diseases ecb05031   Amphetamine addiction ecb05034   Alcoholism ecb05133   Pertussis ecb05152   Tuberculosis ecb05163   Human cytomegalovirus infection ecb05167   Kaposi sarcoma-associated herpesvirus infection ecb05170   Human immunodeficiency virus 1 infection ecb05200   Pathways in cancer ecb05214   Glioma ecb05417   Lipid and atherosclerosis ecb05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:ecb00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     100070422    04015 Rap1 signaling pathway     100070422    04371 Apelin signaling pathway     100070422    04020 Calcium signaling pathway     100070422    04070 Phosphatidylinositol signaling system     100070422    04024 cAMP signaling pathway     100070422    04022 cGMP-PKG signaling pathway     100070422  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     100070422    04218 Cellular senescence     100070422  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     100070422   09152 Endocrine system    04910 Insulin signaling pathway     100070422    04922 Glucagon signaling pathway     100070422    04912 GnRH signaling pathway     100070422    04915 Estrogen signaling pathway     100070422    04921 Oxytocin signaling pathway     100070422    04916 Melanogenesis     100070422    04924 Renin secretion     100070422    04925 Aldosterone synthesis and secretion     100070422   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     100070422    04270 Vascular smooth muscle contraction     100070422   09154 Digestive system    04970 Salivary secretion     100070422    04971 Gastric acid secretion     100070422   09156 Nervous system    04728 Dopaminergic synapse     100070422    04720 Long-term potentiation     100070422    04722 Neurotrophin signaling pathway     100070422   09157 Sensory system    04744 Phototransduction     100070422    04740 Olfactory transduction     100070422    04750 Inflammatory mediator regulation of TRP channels     100070422   09159 Environmental adaptation    04713 Circadian entrainment     100070422  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100070422   09162 Cancer: specific types    05214 Glioma     100070422   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     100070422    05163 Human cytomegalovirus infection     100070422    05167 Kaposi sarcoma-associated herpesvirus infection     100070422   09171 Infectious disease: bacterial    05133 Pertussis     100070422    05152 Tuberculosis     100070422   09164 Neurodegenerative disease    05010 Alzheimer disease     100070422    05012 Parkinson disease     100070422    05022 Pathways of neurodegeneration - multiple diseases     100070422   09165 Substance dependence    05031 Amphetamine addiction     100070422    05034 Alcoholism     100070422   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     100070422    05418 Fluid shear stress and atherosclerosis     100070422  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:ecb01009]     100070422   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ecb04131]     100070422    03036 Chromosome and associated proteins [BR:ecb03036]     100070422   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ecb04147]     100070422 Protein phosphatases and associated proteins [BR:ecb01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      100070422 Membrane trafficking [BR:ecb04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     100070422 Chromosome and associated proteins [BR:ecb03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      100070422 Exosome [BR:ecb04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    100070422 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_8 EF-hand_5 AIF-1 EF-hand_9 EF-hand_4 SPARC_Ca_bdg DUF5580_M EFhand_Ca_insen Caleosin Dockerin_1 EF-hand_11 Latarcin dCache_2 PhageMin_Tail Motif Other DBs NCBI-GeneID:  100070422 NCBI-ProteinID:  XP_014592591 Ensembl:  ENSECAG00000006393 LinkDB All DBs Position 29:complement(29521685..29523298) Genome browser AA seq 149 aa AA seqDB search MADELTEEQVAVFREAFALFDKDGDGIITTQELGTVMRSLGQSPTEAELQGMVSKVDHDG NRTVDFPEFLDMMAKKMKDRDSEEEIREAFRMFDKDGNGFISTAELRHMTTRLGEKLTKE EVDKMIRAADVDGDGQVNYEEFVRMLVPK NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atggctgatgagctgacagaggagcaggtggccgtcttcagggaggccttcgccctgttc gacaaggatggggatggcatcatcaccacccaggagctgggcactgtcatgcggtcccta ggccagagccccacagaggccgagctacagggcatggtgagcaaggtcgaccatgatggc aacaggaccgtggacttccctgagttcctggacatgatggccaagaagatgaaggacagg gacagtgaggaagagatccgggaggccttccgcatgttcgacaaggatggcaacggcttc atcagcacggctgagctacggcacatgacaaccaggctgggagagaagctgaccaaagag gaggtggacaagatgatccgggcagccgatgtggatggggatgggcaggtgaactatgag gagttcgtccgcatgctggtccccaagtga

DBGET integrated database retrieval system