Equus caballus (horse): 100072461 Help Entry 100072461         CDS       T01058                                  Symbol FGF22 Name (RefSeq) fibroblast growth factor 22   KO K04358   fibroblast growth factor Organism ecb  Equus caballus (horse) Pathway ecb04010   MAPK signaling pathway ecb04014   Ras signaling pathway ecb04015   Rap1 signaling pathway ecb04020   Calcium signaling pathway ecb04151   PI3K-Akt signaling pathway ecb04810   Regulation of actin cytoskeleton ecb05200   Pathways in cancer ecb05207   Chemical carcinogenesis - receptor activation ecb05218   Melanoma ecb05224   Breast cancer ecb05226   Gastric cancer Brite KEGG Orthology (KO) [BR:ecb00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     100072461 (FGF22)    04014 Ras signaling pathway     100072461 (FGF22)    04015 Rap1 signaling pathway     100072461 (FGF22)    04020 Calcium signaling pathway     100072461 (FGF22)    04151 PI3K-Akt signaling pathway     100072461 (FGF22)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     100072461 (FGF22)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100072461 (FGF22)    05207 Chemical carcinogenesis - receptor activation     100072461 (FGF22)   09162 Cancer: specific types    05226 Gastric cancer     100072461 (FGF22)    05218 Melanoma     100072461 (FGF22)    05224 Breast cancer     100072461 (FGF22)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ecb04052]     100072461 (FGF22)    00536 Glycosaminoglycan binding proteins [BR:ecb00536]     100072461 (FGF22) Cytokines and neuropeptides [BR:ecb04052]  Cytokines   Growth factors (RTK binding)    100072461 (FGF22) Glycosaminoglycan binding proteins [BR:ecb00536]  Heparan sulfate / Heparin   Growth factors/receptors    100072461 (FGF22) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FGF Fascin Motif Other DBs NCBI-GeneID:  100072461 NCBI-ProteinID:  XP_023500038 LinkDB All DBs Position 7:239595..243071 Genome browser AA seq 170 aa AA seqDB search MRGRLWLGLAWLLLARAPGAAGTPGGPRRARSYPHLEGDVRWRRLFSSTHFFLGVDPSGR VQGTRWRHSPDSVLEIRSLRVGVVALKAVHTGFYVAMSRRGRLYGSRVCTAHCSFRERIE ENGYNTYASVRWRHRGRPMFLALDGQGAPRRGGRTRVHHLSTHFLPVLVS NT seq 513 nt NT seq  +upstreamnt  +downstreamnt atgcgcggccgcctgtggctgggcctggcgtggctgctgctggcgcgggcgcccggcgcc gcggggacccccggcggtccgcggagagcgcgcagctacccgcacctggagggcgacgtg cgctggcggcgcctcttctcctccacccacttcttcctgggcgtggaccccagcggccgc gtgcagggcacccgctggcgccacagccctgacagcgtcctggagatccgctccctccgc gtgggtgttgtggccctcaaggccgtgcacaccggcttctacgtggccatgagccgccgg ggccgcctctacgggtcgagggtctgcaccgcccactgcagtttccgggagcgcattgag gagaacggctacaacacatacgcctcggtccgctggcgccaccgtggccggcccatgttc ctggcgctggacgggcagggggccccgcgtcgtggtggccggacgcgggtgcaccaccta tccacccacttcctgcccgtcctggtgtcttga

DBGET integrated database retrieval system