Escherichia coli O81 ED1a (commensal): ECED1_4295 Help Entry ECED1_4295        CDS       T00827                                  Symbol secB Name (GenBank) protein export chaperone   KO K03071   preprotein translocase subunit SecB Organism ecq  Escherichia coli O81 ED1a (commensal) Pathway ecq02024   Quorum sensing ecq03060   Protein export ecq03070   Bacterial secretion system Brite KEGG Orthology (KO) [BR:ecq00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     ECED1_4295 (secB)  09130 Environmental Information Processing   09131 Membrane transport    03070 Bacterial secretion system     ECED1_4295 (secB)  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     ECED1_4295 (secB)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:ecq03110]     ECED1_4295 (secB)   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:ecq02044]     ECED1_4295 (secB) Chaperones and folding catalysts [BR:ecq03110]  Other chaperones and cochaperones   SecB    ECED1_4295 (secB) Secretion system [BR:ecq02044]  Sec (secretion) system   Prokaryotic Sec-SRP core components    ECED1_4295 (secB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  SecB Motif Other DBs NCBI-ProteinID:  CAR10426 UniProt:  B7N255 LinkDB All DBs Position complement(4220800..4221267) Genome browser AA seq 155 aa AA seqDB search MSEQNNTEMTFQIQRIYTKDISFEAPNAPHVFQKDWQPEVKLDLDTASTQLADDVYEVVL RVTVTASLGEETAFLCEVQQGGIFSIAGIEGTQMAHCLGAYCPNILFPYARECITSMVSR GTFPQLNLAPVNFDALFMNYLQQQAGEGTEEHQDA NT seq 468 nt NT seq  +upstreamnt  +downstreamnt atgtcagaacaaaacaacaccgaaatgactttccagatccaacgtatttataccaaggat atttctttcgaagcgccgaacgcgccgcacgttttccagaaagattggcaaccagaagtt aaacttgatctggatacggcatctactcaactggcagatgacgtttacgaagtggtactg cgtgttaccgtaacggcctccctgggcgaagaaaccgcgttcctgtgtgaagttcagcag ggcggtattttctccatcgcgggtatcgaaggcacccagatggcacattgcctgggcgca tactgcccgaacattctgttcccgtatgctcgtgagtgcatcaccagcatggtatcccgc ggtacattcccgcaactgaaccttgcgccggttaacttcgatgcgctgttcatgaactat ttgcagcagcaggctggcgaaggtactgaagaacatcaggatgcctga

DBGET integrated database retrieval system