Escherichia coli O81 ED1a (commensal): ECED1_5112 Help Entry ECED1_5112        CDS       T00827                                  Symbol holC Name (GenBank) DNA polymerase III, chi subunit   KO K02339   DNA polymerase III subunit chi [EC:2.7.7.7] Organism ecq  Escherichia coli O81 ED1a (commensal) Pathway ecq03030   DNA replication ecq03430   Mismatch repair ecq03440   Homologous recombination Brite KEGG Orthology (KO) [BR:ecq00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     ECED1_5112 (holC)    03430 Mismatch repair     ECED1_5112 (holC)    03440 Homologous recombination     ECED1_5112 (holC)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:ecq03032]     ECED1_5112 (holC)    03400 DNA repair and recombination proteins [BR:ecq03400]     ECED1_5112 (holC) Enzymes [BR:ecq01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.7  Nucleotidyltransferases     2.7.7.7  DNA-directed DNA polymerase      ECED1_5112 (holC) DNA replication proteins [BR:ecq03032]  Prokaryotic type   DNA Replication Elongation Factors    Elongation factors (bacterial)     DNA polymerase III holoenzyme      ECED1_5112 (holC) DNA repair and recombination proteins [BR:ecq03400]  Prokaryotic type   SSBR (single strand breaks repair)    MMR (mismatch excision repair)     DNA polymerase III holoenzyme      ECED1_5112 (holC) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DNA_pol3_chi Motif Other DBs NCBI-ProteinID:  CAR11067 UniProt:  B7MSZ2 LinkDB All DBs Position complement(5052970..5053413) Genome browser AA seq 147 aa AA seqDB search MKNATFYLLDNDTTVDGLSAVEQLVCEIAAERWRSGKRVLIACEDEKQAYRLDEALWARP AESFVPHNLAGEGPRGGAPVEIAWPQKRSSSPRDILISLRTSFADFATAFTEVVDFVPYE DSLKQLARERYKAYRVAGFNLNTATWK NT seq 444 nt NT seq  +upstreamnt  +downstreamnt atgaaaaacgcaacgttctaccttctggacaatgacaccaccgtcgatggcttaagcgcc gttgagcagttggtgtgtgaaattgccgcagaacgttggcgcagtggtaagcgcgtactc atcgcctgtgaagatgaaaagcaggcttaccgactggatgaagccctgtgggcgcgtccg gcagaaagctttgttccgcataatttagcgggagaaggaccgcgcggcggtgcgccggtg gagatcgcctggccgcaaaagcgcagcagcagcccgcgcgatatattgattagtctgcga acaagctttgcagattttgccaccgctttcacagaagtggtagacttcgttccttatgaa gattctctgaaacaactggcgcgcgaacgctataaagcctaccgcgtggctggtttcaac ctgaatacggcaacctggaaataa

DBGET integrated database retrieval system