Eptesicus fuscus (big brown bat): 103284067 Help Entry 103284067         CDS       T09083                                  Symbol JUN Name (RefSeq) transcription factor Jun   KO K04448   transcription factor AP-1 Organism efus  Eptesicus fuscus (big brown bat) Pathway efus01522   Endocrine resistance efus04010   MAPK signaling pathway efus04012   ErbB signaling pathway efus04024   cAMP signaling pathway efus04137   Mitophagy - animal efus04210   Apoptosis efus04310   Wnt signaling pathway efus04380   Osteoclast differentiation efus04510   Focal adhesion efus04530   Tight junction efus04620   Toll-like receptor signaling pathway efus04621   NOD-like receptor signaling pathway efus04625   C-type lectin receptor signaling pathway efus04657   IL-17 signaling pathway efus04658   Th1 and Th2 cell differentiation efus04659   Th17 cell differentiation efus04660   T cell receptor signaling pathway efus04662   B cell receptor signaling pathway efus04668   TNF signaling pathway efus04722   Neurotrophin signaling pathway efus04912   GnRH signaling pathway efus04915   Estrogen signaling pathway efus04921   Oxytocin signaling pathway efus04926   Relaxin signaling pathway efus04932   Non-alcoholic fatty liver disease efus04933   AGE-RAGE signaling pathway in diabetic complications efus05030   Cocaine addiction efus05031   Amphetamine addiction efus05132   Salmonella infection efus05133   Pertussis efus05135   Yersinia infection efus05140   Leishmaniasis efus05142   Chagas disease efus05161   Hepatitis B efus05162   Measles efus05166   Human T-cell leukemia virus 1 infection efus05167   Kaposi sarcoma-associated herpesvirus infection efus05169   Epstein-Barr virus infection efus05170   Human immunodeficiency virus 1 infection efus05171   Coronavirus disease - COVID-19 efus05200   Pathways in cancer efus05203   Viral carcinogenesis efus05207   Chemical carcinogenesis - receptor activation efus05208   Chemical carcinogenesis - reactive oxygen species efus05210   Colorectal cancer efus05211   Renal cell carcinoma efus05224   Breast cancer efus05231   Choline metabolism in cancer efus05235   PD-L1 expression and PD-1 checkpoint pathway in cancer efus05321   Inflammatory bowel disease efus05323   Rheumatoid arthritis efus05417   Lipid and atherosclerosis efus05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:efus00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     103284067 (JUN)    04012 ErbB signaling pathway     103284067 (JUN)    04310 Wnt signaling pathway     103284067 (JUN)    04668 TNF signaling pathway     103284067 (JUN)    04024 cAMP signaling pathway     103284067 (JUN)  09140 Cellular Processes   09141 Transport and catabolism    04137 Mitophagy - animal     103284067 (JUN)   09143 Cell growth and death    04210 Apoptosis     103284067 (JUN)   09144 Cellular community - eukaryotes    04510 Focal adhesion     103284067 (JUN)    04530 Tight junction     103284067 (JUN)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     103284067 (JUN)    04621 NOD-like receptor signaling pathway     103284067 (JUN)    04625 C-type lectin receptor signaling pathway     103284067 (JUN)    04660 T cell receptor signaling pathway     103284067 (JUN)    04658 Th1 and Th2 cell differentiation     103284067 (JUN)    04659 Th17 cell differentiation     103284067 (JUN)    04657 IL-17 signaling pathway     103284067 (JUN)    04662 B cell receptor signaling pathway     103284067 (JUN)   09152 Endocrine system    04912 GnRH signaling pathway     103284067 (JUN)    04915 Estrogen signaling pathway     103284067 (JUN)    04921 Oxytocin signaling pathway     103284067 (JUN)    04926 Relaxin signaling pathway     103284067 (JUN)   09156 Nervous system    04722 Neurotrophin signaling pathway     103284067 (JUN)   09158 Development and regeneration    04380 Osteoclast differentiation     103284067 (JUN)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     103284067 (JUN)    05207 Chemical carcinogenesis - receptor activation     103284067 (JUN)    05208 Chemical carcinogenesis - reactive oxygen species     103284067 (JUN)    05203 Viral carcinogenesis     103284067 (JUN)    05231 Choline metabolism in cancer     103284067 (JUN)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     103284067 (JUN)   09162 Cancer: specific types    05210 Colorectal cancer     103284067 (JUN)    05211 Renal cell carcinoma     103284067 (JUN)    05224 Breast cancer     103284067 (JUN)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     103284067 (JUN)    05170 Human immunodeficiency virus 1 infection     103284067 (JUN)    05161 Hepatitis B     103284067 (JUN)    05171 Coronavirus disease - COVID-19     103284067 (JUN)    05162 Measles     103284067 (JUN)    05167 Kaposi sarcoma-associated herpesvirus infection     103284067 (JUN)    05169 Epstein-Barr virus infection     103284067 (JUN)   09171 Infectious disease: bacterial    05132 Salmonella infection     103284067 (JUN)    05135 Yersinia infection     103284067 (JUN)    05133 Pertussis     103284067 (JUN)   09174 Infectious disease: parasitic    05140 Leishmaniasis     103284067 (JUN)    05142 Chagas disease     103284067 (JUN)   09163 Immune disease    05323 Rheumatoid arthritis     103284067 (JUN)    05321 Inflammatory bowel disease     103284067 (JUN)   09165 Substance dependence    05030 Cocaine addiction     103284067 (JUN)    05031 Amphetamine addiction     103284067 (JUN)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     103284067 (JUN)    05418 Fluid shear stress and atherosclerosis     103284067 (JUN)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     103284067 (JUN)    04933 AGE-RAGE signaling pathway in diabetic complications     103284067 (JUN)   09176 Drug resistance: antineoplastic    01522 Endocrine resistance     103284067 (JUN)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:efus03000]     103284067 (JUN) Transcription factors [BR:efus03000]  Eukaryotic type   Basic leucine zipper (bZIP)    AP-1(-like) components, Jun     103284067 (JUN) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Jun bZIP_1 bZIP_2 bZIP_Maf ZapB PspA_IM30 Fib_alpha ATG16 FlaC_arch DUF3450 TFIIA NYD-SP28_assoc Motif Other DBs NCBI-GeneID:  103284067 NCBI-ProteinID:  XP_008137593 LinkDB All DBs Position 9:complement(40534783..40537510) Genome browser AA seq 333 aa AA seqDB search MTAKMETTFYDDALNASFLQSESGAYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDL LTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAE LHSQNTLPSVTSAAQPVSGAGMVAPAVASVAGGSGSGGFSASLHSEPPVYANLSNFNPGA LSGGGAPSYGATGLAFAAQPQQQQQPPQPPHHLPQQIPVQHPRLQALKEEPQTVPEMPGE TPPLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELASTA NMLREQVAQLKQKVMNHVNSGCQLMLTQQLQTF NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt atgactgcaaagatggaaacgaccttctacgatgatgccctcaacgcctcgttcctccag tccgagagcggtgcctacggctacagtaaccccaagatcctgaaacagagcatgaccctg aacctggccgatccagtgggcagcctgaagccgcacctgcgggccaagaactcggacctc ctcacctcgcccgatgtggggctgctcaaactggcgtcgcccgagctggagcgcctgatc atccagtccagcaatgggcacatcaccaccacgccgacccccacccagttcttgtgcccc aagaacgtgacggacgagcaggagggctttgccgagggcttcgtgcgcgccctggccgaa ctgcacagccagaacacgctgcccagcgttacgtccgcggcgcagccggtcagcggggca ggcatggtggctccggccgtggcttcggtggcgggcggcagcggcagcggcggcttcagc gccagcctgcacagcgagccgccagtctacgccaacctcagcaacttcaacccgggcgcg ctgagcggcggcggggcgccctcctacggcgcgactggcctggcgtttgccgcgcagccc cagcagcagcagcagccaccgcaaccgccgcaccacctgccccagcagatcccggtgcag cacccgcggctgcaggccctgaaggaggagccgcagacggtgcccgaaatgcccggggaa acaccgcccctctcccccatcgacatggagtcccaggagcggatcaaggcggagaggaag cgcatgaggaaccgcatcgctgcctccaagtgccggaaaaggaagctggagagaatcgcc cggctggaggaaaaagtgaaaaccttgaaagcgcagaactcggagctggcgtctacagcc aacatgctcagggaacaggtggcacagcttaagcagaaagtcatgaaccacgttaatagt gggtgccaactcatgctaacgcagcagttgcaaacgttttga

DBGET integrated database retrieval system