Eptesicus fuscus (big brown bat): 103289838 Help Entry 103289838         CDS       T09083                                  Symbol SOD1 Name (RefSeq) superoxide dismutase [Cu-Zn]   KO K04565   superoxide dismutase, Cu-Zn family [EC:1.15.1.1] Organism efus  Eptesicus fuscus (big brown bat) Pathway efus04146   Peroxisome efus04213   Longevity regulating pathway - multiple species efus05012   Parkinson disease efus05014   Amyotrophic lateral sclerosis efus05016   Huntington disease efus05020   Prion disease efus05022   Pathways of neurodegeneration - multiple diseases efus05208   Chemical carcinogenesis - reactive oxygen species Brite KEGG Orthology (KO) [BR:efus00001]  09140 Cellular Processes   09141 Transport and catabolism    04146 Peroxisome     103289838 (SOD1)  09150 Organismal Systems   09149 Aging    04213 Longevity regulating pathway - multiple species     103289838 (SOD1)  09160 Human Diseases   09161 Cancer: overview    05208 Chemical carcinogenesis - reactive oxygen species     103289838 (SOD1)   09164 Neurodegenerative disease    05012 Parkinson disease     103289838 (SOD1)    05014 Amyotrophic lateral sclerosis     103289838 (SOD1)    05016 Huntington disease     103289838 (SOD1)    05020 Prion disease     103289838 (SOD1)    05022 Pathways of neurodegeneration - multiple diseases     103289838 (SOD1) Enzymes [BR:efus01000]  1. Oxidoreductases   1.15  Acting on superoxide as acceptor    1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)     1.15.1.1  superoxide dismutase      103289838 (SOD1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Sod_Cu Motif Other DBs NCBI-GeneID:  103289838 NCBI-ProteinID:  XP_028007750 LinkDB All DBs Position 3:1064759..1071077 Genome browser AA seq 153 aa AA seqDB search MTTKAVCVLQGEGEVRGTIHFEQKGNGKVTVSGSIMGLAEGEHGFHVHQFGDNTQGCTSA GPHFNPLSKNHGGPQDDERHVGDLGNVMAGPNGVAEVLIEDSMIKLSGDHSIIGRTMVVH EKRDDLGRGGNDESKKTGNAGSRLACGVIGIAQ NT seq 462 nt NT seq  +upstreamnt  +downstreamnt atgacgaccaaggccgtgtgcgtgctgcagggcgagggcgaagtgcggggcaccatccac ttcgagcagaagggaaacgggaaggtcacggtctcgggctccatcatgggcctggccgag ggcgagcacggcttccacgtccaccagtttggagacaacacacaaggctgtaccagcgct ggtcctcactttaacccgctgtccaagaaccacggcgggccgcaggacgacgagaggcat gtcggggatctgggcaacgtgatggcgggccctaacggcgtggccgaggtgctcatcgaa gactccatgatcaagctctcaggagaccattccatcatcggccgcacaatggtggtccac gagaagcgagacgacctgggcagagggggcaacgacgagagcaagaagacgggcaacgcc ggcagccgcctggcctgcggggtgatcgggatcgcccagtga

DBGET integrated database retrieval system