Egretta garzetta (little egret): 104128804 Help Entry 104128804         CDS       T05152                                  Name (RefSeq) cystatin-like   KO K13899   cystatin-C Organism egz  Egretta garzetta (little egret) Brite KEGG Orthology (KO) [BR:egz00001]  09180 Brite Hierarchies   09181 Protein families: metabolism    01002 Peptidases and inhibitors [BR:egz01002]     104128804   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:egz04147]     104128804 Peptidases and inhibitors [BR:egz01002]  Peptidase inhibitors   Family I25: cystatin family    104128804 Exosome [BR:egz04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    104128804 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Cystatin Motif Other DBs NCBI-GeneID:  104128804 NCBI-ProteinID:  XP_009639948 LinkDB All DBs Position Unknown AA seq 76 aa AA seqDB search MSRVVGVISAKRQIVSGIKYIMEVEIGRTTCPKPATDLQSCALHEAPQMAKHTTCNFVVY TIPWLNQIKLLTSSCR NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atgagccgggtggtgggggtcatcagcgccaagaggcagattgtatccggaatcaagtac ataatggaagttgagataggccggacaacttgcccaaagccagcaactgatctccagagc tgcgctctccatgaagcaccgcagatggctaagcacaccacttgcaactttgtggtgtat actattccttggctaaaccaaattaaactactgacaagtagctgccgataa

DBGET integrated database retrieval system