Eumetopias jubatus (Steller sea lion): 114217149 Help Entry 114217149         CDS       T07240                                  Symbol SOD1 Name (RefSeq) superoxide dismutase [Cu-Zn]   KO K04565   superoxide dismutase, Cu-Zn family [EC:1.15.1.1] Organism eju  Eumetopias jubatus (Steller sea lion) Pathway eju04146   Peroxisome eju04213   Longevity regulating pathway - multiple species eju05012   Parkinson disease eju05014   Amyotrophic lateral sclerosis eju05016   Huntington disease eju05020   Prion disease eju05022   Pathways of neurodegeneration - multiple diseases eju05208   Chemical carcinogenesis - reactive oxygen species Brite KEGG Orthology (KO) [BR:eju00001]  09140 Cellular Processes   09141 Transport and catabolism    04146 Peroxisome     114217149 (SOD1)  09150 Organismal Systems   09149 Aging    04213 Longevity regulating pathway - multiple species     114217149 (SOD1)  09160 Human Diseases   09161 Cancer: overview    05208 Chemical carcinogenesis - reactive oxygen species     114217149 (SOD1)   09164 Neurodegenerative disease    05012 Parkinson disease     114217149 (SOD1)    05014 Amyotrophic lateral sclerosis     114217149 (SOD1)    05016 Huntington disease     114217149 (SOD1)    05020 Prion disease     114217149 (SOD1)    05022 Pathways of neurodegeneration - multiple diseases     114217149 (SOD1) Enzymes [BR:eju01000]  1. Oxidoreductases   1.15  Acting on superoxide as acceptor    1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)     1.15.1.1  superoxide dismutase      114217149 (SOD1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Sod_Cu Motif Other DBs NCBI-GeneID:  114217149 NCBI-ProteinID:  XP_027969751 LinkDB All DBs Position Unknown AA seq 153 aa AA seqDB search MEMKAVCVLKGQGPVEGTIHFVQKGSGPVVVSGTITGLTEGEHGFHVHQFGDNTQGCTSA GPHFNPLSKKHGGPNDQERHVGDLGNVTAGKDGVATVSLEDPLIALSGDHSIIGRTMVVH EKRDDLGKGGNEESTQTGNAGSRLACGVIGIAK NT seq 462 nt NT seq  +upstreamnt  +downstreamnt atggagatgaaggccgtgtgcgtgctgaagggccagggcccggtggagggcaccatccac ttcgtgcagaagggaagtgggcctgttgtggtgtcaggaaccattacgggattgactgaa ggtgagcatggattccacgtccatcaatttggagataatacccaaggctgtaccagtgca ggtcctcactttaatcctctatccaaaaaacacggtgggccaaacgatcaagagaggcat gttggagacctgggcaacgtgactgctggcaaggatggtgtggccaccgtgtccttggaa gatcctctgatcgcactctcaggagaccattccatcattggccgcacaatggtggtccac gagaaacgagatgacttgggcaaaggtggcaatgaagaaagtacacagacgggaaacgcc gggagtcgtttggcttgtggtgtcattgggatcgccaagtaa

DBGET integrated database retrieval system