Fusarium oxysporum: FOXG_08172 Help Entry FOXG_08172        CDS       T04882                                  Name (RefSeq) histone H2B   KO K11252   histone H2B Organism fox  Fusarium oxysporum Brite KEGG Orthology (KO) [BR:fox00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:fox03036]     FOXG_08172   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:fox04147]     FOXG_08172 Chromosome and associated proteins [BR:fox03036]  Eukaryotic type   Nucleosome assembly factors    Histones     FOXG_08172 Exosome [BR:fox04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    FOXG_08172 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone Motif Other DBs NCBI-GeneID:  28949820 NCBI-ProteinID:  XP_018244167 UniProt:  A0A0J9WMU1 LinkDB All DBs Position 4:complement(2321666..2321869) Genome browser AA seq 67 aa AA seqDB search QLDLTSGPDIFERVASEASKLAAYNKKSTISSREIQTSVRLILPGELAKHAVSEGTKAVT KYSSSTK NT seq 204 nt NT seq  +upstreamnt  +downstreamnt caacttgatctgacttctggtccagacatcttcgagcgcgtcgcttctgaggcttccaag cttgccgcctacaacaagaagtccaccatctcttcccgagagatccagacttctgtccgc ctcatcctccccggtgagcttgccaagcacgccgtctctgagggtaccaaggctgtcacc aagtactcctcctcgacgaaataa

DBGET integrated database retrieval system