Geospiza fortis (medium ground-finch): 102034467 Help Entry 102034467         CDS       T03755                                  Name (RefSeq) C-C motif chemokine 4 homolog   KO K12964   C-C motif chemokine 4 Organism gfr  Geospiza fortis (medium ground-finch) Pathway gfr04060   Cytokine-cytokine receptor interaction gfr04620   Toll-like receptor signaling pathway gfr04623   Cytosolic DNA-sensing pathway Brite KEGG Orthology (KO) [BR:gfr00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     102034467  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     102034467    04623 Cytosolic DNA-sensing pathway     102034467  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:gfr04052]     102034467 Cytokines and neuropeptides [BR:gfr04052]  Cytokines   Chemokines    102034467 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 VMAP-M4 Motif Other DBs NCBI-GeneID:  102034467 NCBI-ProteinID:  XP_005425190 UniProt:  A0A6I9HLN9 LinkDB All DBs Position Un AA seq 90 aa AA seqDB search MKVFVVALTILVIAVCYQTSAAPLGSDPPTSCCFSYVSRQLPRSFVKDYYETNSQCSQPA VVFITRKGREVCANPMEDWVQQYVNELELD NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgaaggtgtttgtggttgccctcaccatcctcgtcattgccgtctgctaccagacctct gctgctccacttggctccgacccaccaacctcctgctgcttctcctacgtctcgcggcag ctgccccgcagctttgtgaaggattactacgaaaccaacagccagtgctcccagcctgct gtcgtgttcatcaccaggaagggccgggaagtctgtgccaaccccatggaggactgggtc cagcagtacgtgaatgagctagagctggactga

DBGET integrated database retrieval system