Gossypium hirsutum (upland cotton): 107960807 Help Entry 107960807         CDS       T04793                                  Name (RefSeq) RING-box protein 1-like   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism ghi  Gossypium hirsutum (upland cotton) Pathway ghi03420   Nucleotide excision repair ghi04120   Ubiquitin mediated proteolysis ghi04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:ghi00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     107960807    04120 Ubiquitin mediated proteolysis     107960807   09124 Replication and repair    03420 Nucleotide excision repair     107960807  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:ghi04121]     107960807    03400 DNA repair and recombination proteins [BR:ghi03400]     107960807 Enzymes [BR:ghi01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      107960807 Ubiquitin system [BR:ghi04121]  Ubiquitin ligases (E3)   UBL E3 ligases    107960807   Multi subunit Ring-finger type E3    SCF complex     Ring finger protein      107960807    Cul2 complex      107960807    Cul3 complex      107960807    Cul4 complex      107960807    Cul7 complex      107960807    Cul8 complex      107960807    Cul9 complex      107960807 DNA repair and recombination proteins [BR:ghi03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       107960807     TCR (transcription coupled repair) factors      Cul4-CSA complex       107960807 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4_2 zf-RING_11 zf-C3HC4 RH_dom Motif Other DBs NCBI-GeneID:  107960807 NCBI-ProteinID:  XP_016752573 UniProt:  A0A1U8PQE5 LinkDB All DBs Position A05:3527352..3532765 Genome browser AA seq 140 aa AA seqDB search MAVHQPMCIRRPGICEFCERERISSRPICSVPAMSTQTSGSTAPSSSTEDPKHFDMKKWS SVALWSWDIVVDNCAVCRNHIMDLCIECQTNQIVGADNECTVAWGACNHAFHFHCISRWL QNRSVCPLDNAEWEFRKYGR NT seq 423 nt NT seq  +upstreamnt  +downstreamnt atggctgttcaccagccaatgtgtatcagaaggccaggtatatgtgagttttgtgagaga gaaagaatttcttcccgccctatttgttcggtcccagccatgtctacccaaacttccggc agcaccgccccttcctcctccactgaggaccccaagcacttcgatatgaaaaagtggagt tcggttgccctctggtcctgggatattgtcgtggataattgtgcggtttgcaggaatcac atcatggatctctgtatcgaatgccaaaccaaccaaatagtcggtgccgataatgaatgc actgttgcgtggggtgcatgcaaccatgcattccactttcactgcattagtcgatggctg cagaaccggtcagtatgtcctttggataatgctgaatgggagttccgaaagtatggtcgc tag

DBGET integrated database retrieval system