Glycine soja (wild soybean): 114378451 Help Entry 114378451         CDS       T06057                                  Name (RefSeq) RING-box protein 1a isoform X1   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism gsj  Glycine soja (wild soybean) Pathway gsj03420   Nucleotide excision repair gsj04120   Ubiquitin mediated proteolysis gsj04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:gsj00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     114378451    04120 Ubiquitin mediated proteolysis     114378451   09124 Replication and repair    03420 Nucleotide excision repair     114378451  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:gsj04121]     114378451    03400 DNA repair and recombination proteins [BR:gsj03400]     114378451 Enzymes [BR:gsj01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      114378451 Ubiquitin system [BR:gsj04121]  Ubiquitin ligases (E3)   UBL E3 ligases    114378451   Multi subunit Ring-finger type E3    SCF complex     Ring finger protein      114378451    Cul2 complex      114378451    Cul3 complex      114378451    Cul4 complex      114378451    Cul7 complex      114378451    Cul8 complex      114378451    Cul9 complex      114378451 DNA repair and recombination proteins [BR:gsj03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       114378451     TCR (transcription coupled repair) factors      Cul4-CSA complex       114378451 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-RING_11 Motif Other DBs NCBI-GeneID:  114378451 NCBI-ProteinID:  XP_028192842 LinkDB All DBs Position 12:40035819..40038124 Genome browser AA seq 126 aa AA seqDB search MATLDSDVTVFPAGEASSSAGPSSSTKKPKRFEIKKWNAVSLWAWDIVVDNCAICRNHIM DLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLVFCFFGGIDNSEWE FQKYGH NT seq 381 nt NT seq  +upstreamnt  +downstreamnt atggcgacactggattccgacgtgaccgtgtttccggccggcgaagcctccagcagcgcc ggtccttcttcgtccaccaagaagccgaagcgtttcgagatcaagaagtggaatgcggtt tccctctgggcttgggatattgtcgtggataattgcgctatttgtcggaaccatatcatg gatctctgtattgagtgccaggccaaccaggctagcgccactagcgaggaatgcactgta gcttggggagtttgtaaccatgcttttcacttccattgcataagccgatggctcaagacc cgtcaagtatgtcctctagtgttttgtttttttggtggtatagataatagcgagtgggaa tttcagaaatacggtcactag

DBGET integrated database retrieval system