Glaesserella parasuis SH0165: HAPS_1516 Help Entry HAPS_1516         CDS       T00825                                  Symbol folB Name (GenBank) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism hap  Glaesserella parasuis SH0165 Pathway hap00790   Folate biosynthesis hap01100   Metabolic pathways hap01240   Biosynthesis of cofactors Brite KEGG Orthology (KO) [BR:hap00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     HAPS_1516 (folB) Enzymes [BR:hap01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      HAPS_1516 (folB)  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      HAPS_1516 (folB)  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      HAPS_1516 (folB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB Motif Other DBs NCBI-ProteinID:  ACL33072 UniProt:  B8F6X0 LinkDB All DBs Position complement(1498463..1498810) Genome browser AA seq 115 aa AA seqDB search MTDKVFIHELTAFASIGAYEWEHTIKQRLVFNIEMAWDFSRTVADDDVQYCLNYAEVSQK ILDFVENTPFKLVETVAYRVAELLQHEFGVKSLRIELHKPKAVAQSSSVGVIVER NT seq 348 nt NT seq  +upstreamnt  +downstreamnt atgactgataaagtttttattcacgaactcaccgcttttgcatctattggggcttatgag tgggaacataccattaaacaacgtttagttttcaatattgaaatggcgtgggattttagc cgaactgtcgcagatgatgatgtacagtactgcttaaattatgcggaagtttcacaaaag atccttgattttgttgaaaatacaccgtttaagttggttgaaaccgttgcttatcgagtg gccgaactactgcaacacgagtttggggtgaaatcattacgcattgaattacacaagcct aaagcagttgctcaatcctcaagtgttggtgtaattgttgaacgataa

DBGET integrated database retrieval system