Halorussus salilacus: NGM10_13945 Help Entry NGM10_13945       CDS       T09338                                  Name (GenBank) acc operon protein   KO K22568   acetyl-CoA/propionyl-CoA carboxylase, PccX subunit [EC:6.4.1.2 6.4.1.3] Organism hayc  Halorussus salilacus Pathway hayc00280   Valine, leucine and isoleucine degradation hayc00630   Glyoxylate and dicarboxylate metabolism hayc00640   Propanoate metabolism hayc01100   Metabolic pathways hayc01110   Biosynthesis of secondary metabolites hayc01120   Microbial metabolism in diverse environments hayc01200   Carbon metabolism Module hayc_M00741   Propanoyl-CoA metabolism, propanoyl-CoA => succinyl-CoA Brite KEGG Orthology (KO) [BR:hayc00001]  09100 Metabolism   09101 Carbohydrate metabolism    00630 Glyoxylate and dicarboxylate metabolism     NGM10_13945    00640 Propanoate metabolism     NGM10_13945   09105 Amino acid metabolism    00280 Valine, leucine and isoleucine degradation     NGM10_13945 Enzymes [BR:hayc01000]  6. Ligases   6.4  Forming carbon-carbon bonds    6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)     6.4.1.2  acetyl-CoA carboxylase      NGM10_13945     6.4.1.3  propionyl-CoA carboxylase      NGM10_13945 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Other DBs NCBI-ProteinID:  USZ69682 LinkDB All DBs Position 2698538..2698795 Genome browser AA seq 85 aa AA seqDB search MADADLAIPDDATDEEAAAIAAAIGAHLRAQEAAAAAAESDDEETWDGERWSFAGRLRGL SGRAGRVPTGAPTDAWAAAGRADRF NT seq 258 nt NT seq  +upstreamnt  +downstreamnt ctggcagacgccgacctcgcgattcccgacgacgccaccgacgaggaggccgctgccatc gcggcggccatcggcgcgcacctccgcgcccaagaggccgcggcggccgccgccgagtcg gacgacgaggagacgtgggacggcgaacgctggtcgttcgcgggtcgattgcgggggctg agcgggcgcgccggtcgggtcccgaccggcgcgcccaccgacgcgtgggcggcggccgga cgcgccgaccggttctga

DBGET integrated database retrieval system