Hyaena hyaena (striped hyena): 120221184 Help Entry 120221184         CDS       T07257                                  Name (RefSeq) cytochrome c   KO K08738   cytochrome c Organism hhv  Hyaena hyaena (striped hyena) Pathway hhv00190   Oxidative phosphorylation hhv01100   Metabolic pathways hhv01524   Platinum drug resistance hhv04115   p53 signaling pathway hhv04210   Apoptosis hhv04215   Apoptosis - multiple species hhv04932   Non-alcoholic fatty liver disease hhv05010   Alzheimer disease hhv05012   Parkinson disease hhv05014   Amyotrophic lateral sclerosis hhv05016   Huntington disease hhv05017   Spinocerebellar ataxia hhv05020   Prion disease hhv05022   Pathways of neurodegeneration - multiple diseases hhv05132   Salmonella infection hhv05134   Legionellosis hhv05145   Toxoplasmosis hhv05152   Tuberculosis hhv05160   Hepatitis C hhv05161   Hepatitis B hhv05162   Measles hhv05163   Human cytomegalovirus infection hhv05164   Influenza A hhv05167   Kaposi sarcoma-associated herpesvirus infection hhv05168   Herpes simplex virus 1 infection hhv05169   Epstein-Barr virus infection hhv05170   Human immunodeficiency virus 1 infection hhv05200   Pathways in cancer hhv05210   Colorectal cancer hhv05222   Small cell lung cancer hhv05416   Viral myocarditis hhv05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:hhv00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     120221184  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     120221184    04215 Apoptosis - multiple species     120221184    04115 p53 signaling pathway     120221184  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     120221184   09162 Cancer: specific types    05210 Colorectal cancer     120221184    05222 Small cell lung cancer     120221184   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     120221184    05161 Hepatitis B     120221184    05160 Hepatitis C     120221184    05164 Influenza A     120221184    05162 Measles     120221184    05168 Herpes simplex virus 1 infection     120221184    05163 Human cytomegalovirus infection     120221184    05167 Kaposi sarcoma-associated herpesvirus infection     120221184    05169 Epstein-Barr virus infection     120221184   09171 Infectious disease: bacterial    05132 Salmonella infection     120221184    05134 Legionellosis     120221184    05152 Tuberculosis     120221184   09174 Infectious disease: parasitic    05145 Toxoplasmosis     120221184   09164 Neurodegenerative disease    05010 Alzheimer disease     120221184    05012 Parkinson disease     120221184    05014 Amyotrophic lateral sclerosis     120221184    05016 Huntington disease     120221184    05017 Spinocerebellar ataxia     120221184    05020 Prion disease     120221184    05022 Pathways of neurodegeneration - multiple diseases     120221184   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     120221184    05416 Viral myocarditis     120221184   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     120221184   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     120221184 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Cytochrom_C Cytochrome_CBB3 Cytochrom_C550 CCP_MauG Motif Other DBs NCBI-GeneID:  120221184 NCBI-ProteinID:  XP_039074372 LinkDB All DBs Position Unknown AA seq 105 aa AA seqDB search MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGFSYTDANKNKGITW GEETLMEYLENPKKYIPGTKMIFAGIKKAGERADLIAYLKKATNE NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atgggtgatgttgagaaaggcaagaagatttttgttcagaagtgtgcccagtgccatacc gtggaaaagggaggcaaacacaagacggggccaaatctccatggtttatttgggcgaaag acgggtcaagcccctggattttcttacacggatgccaacaagaacaaaggcatcacctgg ggagaggagacactgatggagtatttggagaatcccaagaagtacatcccaggaacaaaa atgatcttcgctggcattaagaaggcaggggaaagagcagacttgatagcttatctcaaa aaagctactaacgagtaa

DBGET integrated database retrieval system