Hyaena hyaena (striped hyena): 120233937 Help Entry 120233937         CDS       T07257                                  Name (RefSeq) glutathione S-transferase P   KO K23790   glutathione S-transferase P [EC:2.5.1.18] Organism hhv  Hyaena hyaena (striped hyena) Pathway hhv00480   Glutathione metabolism hhv00980   Metabolism of xenobiotics by cytochrome P450 hhv00982   Drug metabolism - cytochrome P450 hhv00983   Drug metabolism - other enzymes hhv01100   Metabolic pathways hhv01524   Platinum drug resistance hhv05200   Pathways in cancer hhv05204   Chemical carcinogenesis - DNA adducts hhv05215   Prostate cancer hhv05225   Hepatocellular carcinoma hhv05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:hhv00001]  09100 Metabolism   09106 Metabolism of other amino acids    00480 Glutathione metabolism     120233937   09111 Xenobiotics biodegradation and metabolism    00980 Metabolism of xenobiotics by cytochrome P450     120233937    00982 Drug metabolism - cytochrome P450     120233937    00983 Drug metabolism - other enzymes     120233937  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     120233937    05204 Chemical carcinogenesis - DNA adducts     120233937   09162 Cancer: specific types    05225 Hepatocellular carcinoma     120233937    05215 Prostate cancer     120233937   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     120233937   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     120233937  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:hhv02000]     120233937 Enzymes [BR:hhv01000]  2. Transferases   2.5  Transferring alkyl or aryl groups, other than methyl groups    2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)     2.5.1.18  glutathione transferase      120233937 Transporters [BR:hhv02000]  Other transporters   Pores ion channels [TC:1]    120233937 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  GST_C_3 GST_C GST_N GST_N_3 GST_C_2 GST_N_2 Motif Other DBs NCBI-GeneID:  120233937 NCBI-ProteinID:  XP_039091448 LinkDB All DBs Position Unknown AA seq 244 aa AA seqDB search MGGTSLIRLEAGQGVSFVACAATAARAAAARAVTMPPYTIVYFPVRGRCEAMRMLLADQG QSWKEEVVTKDAWLQGPLKASCLYGQLPKFQDGDLTLYQSNAILRHLGRTFGLYGKDQRE AALVDVVNDGVEDLRCKYATLIYTNYEGGKQEYVKALPEQLKPFETLLSQNAGGQAFIIG DQISFADYNLLDLLLNHQVLAPGCLDSFPLLSAYVARLSARPKLKAFLASPEHVNRPING NGKQ NT seq 735 nt NT seq  +upstreamnt  +downstreamnt atgggcgggacaagccttataaggctggaggccggacagggtgtgagcttcgtcgcctgc gccgccaccgccgcccgcgccgccgctgctcgcgctgtaaccatgccgccctacaccatt gtctactttcccgttcgagggcgctgcgaggccatgcgcatgctgctggccgaccagggc cagagctggaaggaagaggtggtgaccaaggacgcctggctgcagggcccactcaaggcc tcctgtctgtacgggcagctccccaagttccaggacggagacctcactctgtaccagtcc aatgccatcctgcgacacctgggccgcacctttgggctgtacgggaaggaccagcgggag gcagccctggtggacgtggtgaatgacggggtggaggatcttcgctgcaaatatgccacc ctcatctacaccaactatgagggaggcaagcaggaatatgtgaaggcgctgccggagcag ctgaagccttttgagaccctgctgtcccagaacgcggggggccaggcattcatcattggt gaccagatctccttcgcggactacaacctgctggacttgctgctgaatcaccaggtcctg gctcccggctgcctggactccttccctctgctctcggcctacgtggcgcgcctcagcgcc cggcccaagctcaaggccttcctggcctccccggagcacgtgaaccgccccatcaatggc aatgggaagcagtga

DBGET integrated database retrieval system