Hylobates moloch (silvery gibbon): 116469511 Help Entry 116469511         CDS       T08803                                  Name (RefSeq) histone H2B type 2-F   KO K11252   histone H2B Organism hmh  Hylobates moloch (silvery gibbon) Pathway hmh04613   Neutrophil extracellular trap formation hmh05034   Alcoholism hmh05203   Viral carcinogenesis hmh05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:hmh00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     116469511  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     116469511   09163 Immune disease    05322 Systemic lupus erythematosus     116469511   09165 Substance dependence    05034 Alcoholism     116469511  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:hmh03036]     116469511   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:hmh04147]     116469511 Chromosome and associated proteins [BR:hmh03036]  Eukaryotic type   Nucleosome assembly factors    Histones     116469511 Exosome [BR:hmh04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    116469511 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CBFD_NFYB_HMF TFIID_20kDa YscO-like DUF6246 Motif Other DBs NCBI-GeneID:  116469511 NCBI-ProteinID:  XP_032010735 EnsemblRapid:  ENSHMOG00005002353 LinkDB All DBs Position Unknown AA seq 126 aa AA seqDB search MPDPAKSAPAPKKGSKKAVTKVQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAM GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT KYTSSK NT seq 381 nt NT seq  +upstreamnt  +downstreamnt atgccggatccagcaaaatccgctcctgctcccaagaagggctccaaaaaggctgttacg aaagtgcagaagaaggacggcaagaagcgcaagcgcagccgcaaggagagctactccgtt tacgtgtacaaggtgctgaagcaggtccatcccgacaccggcatctcgtccaaggcaatg gggatcatgaactccttcgtcaacgacatcttcgagcgcatcgcgggagaggcgtcccgc ctggcgcactacaacaagcgctccaccatcacatcccgcgagatccagacggctgtgcgc ctgctgctgcccggcgagctggccaagcacgccgtgtccgagggcaccaaggcagtcacc aagtacaccagctcgaaataa

DBGET integrated database retrieval system