Hylobates moloch (silvery gibbon): 116482392 Help Entry 116482392         CDS       T08803                                  Symbol SOD1 Name (RefSeq) superoxide dismutase [Cu-Zn]   KO K04565   superoxide dismutase, Cu-Zn family [EC:1.15.1.1] Organism hmh  Hylobates moloch (silvery gibbon) Pathway hmh04146   Peroxisome hmh04213   Longevity regulating pathway - multiple species hmh05012   Parkinson disease hmh05014   Amyotrophic lateral sclerosis hmh05016   Huntington disease hmh05020   Prion disease hmh05022   Pathways of neurodegeneration - multiple diseases hmh05208   Chemical carcinogenesis - reactive oxygen species Brite KEGG Orthology (KO) [BR:hmh00001]  09140 Cellular Processes   09141 Transport and catabolism    04146 Peroxisome     116482392 (SOD1)  09150 Organismal Systems   09149 Aging    04213 Longevity regulating pathway - multiple species     116482392 (SOD1)  09160 Human Diseases   09161 Cancer: overview    05208 Chemical carcinogenesis - reactive oxygen species     116482392 (SOD1)   09164 Neurodegenerative disease    05012 Parkinson disease     116482392 (SOD1)    05014 Amyotrophic lateral sclerosis     116482392 (SOD1)    05016 Huntington disease     116482392 (SOD1)    05020 Prion disease     116482392 (SOD1)    05022 Pathways of neurodegeneration - multiple diseases     116482392 (SOD1) Enzymes [BR:hmh01000]  1. Oxidoreductases   1.15  Acting on superoxide as acceptor    1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)     1.15.1.1  superoxide dismutase      116482392 (SOD1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Sod_Cu Motif Other DBs NCBI-GeneID:  116482392 NCBI-ProteinID:  XP_032031667 EnsemblRapid:  ENSHMOG00005026030 LinkDB All DBs Position Unknown AA seq 154 aa AA seqDB search MAMKAVCVLKGDSPVQGIINFEQKESNGPVKVYGRITGLTEGLHGFHVHQFGDNTQGCTS AGPHFNPLSRKHGGPKDEERHVGDLGNVTADKDGVAKVSIEDSVISLSGDHSIIGRTLVV HEKADDLGKGGNEESTKTGNAGSRLACGVIGIAQ NT seq 465 nt NT seq  +upstreamnt  +downstreamnt atggcgatgaaggccgtgtgcgtgctgaagggcgacagcccagtgcagggcatcatcaat ttcgagcagaaggaaagtaatggaccagtgaaggtgtacggaaggattacaggactgact gaaggcctgcatggattccatgttcatcagtttggagataatacgcaaggctgtaccagt gcaggtcctcactttaatcctctatccagaaaacacggtgggccaaaggatgaagagagg catgttggagacttgggcaatgtgactgctgacaaagatggtgtggccaaagtgtctatt gaggattctgtgatctcactctcaggagatcattccatcattggccgcacattggtggtc catgaaaaagcagatgacttgggcaaaggtggaaatgaagaaagtacaaagacaggaaat gctggaagtcgtttggcttgtggtgtaattgggatcgcccaataa

DBGET integrated database retrieval system