KEGG   Homo sapiens (human): 383Help
Entry
383               CDS       T01001                                 

Gene name
ARG1
Definition
(RefSeq) arginase 1 (EC:3.5.3.1)
  KO
K01476  
arginase [EC:3.5.3.1]
Organism
hsa  Homo sapiens (human)
Pathway
Arginine biosynthesis
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of antibiotics
Biosynthesis of amino acids
Amoebiasis
Module
Urea cycle
Polyamine biosynthesis, arginine => ornithine => putrescine
Disease
H00186  
Hyperargininemia
H01398  
Primary hyperammonemic disorders
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    383 (ARG1)
  Amino acid metabolism
   00220 Arginine biosynthesis
    383 (ARG1)
   00330 Arginine and proline metabolism
    383 (ARG1)
 Human Diseases
  Infectious diseases
   05146 Amoebiasis
    383 (ARG1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     383 (ARG1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
6q23
AA seq 322 aa AA seqDB search
MSAKSRTIGIIGAPFSKGQPRGGVEEGPTVLRKAGLLEKLKEQECDVKDYGDLPFADIPN
DSPFQIVKNPRSVGKASEQLAGKVAEVKKNGRISLVLGGDHSLAIGSISGHARVHPDLGV
IWVDAHTDINTPLTTTSGNLHGQPVSFLLKELKGKIPDVPGFSWVTPCISAKDIVYIGLR
DVDPGEHYILKTLGIKYFSMTEVDRLGIGKVMEETLSYLLGRKKRPIHLSFDVDGLDPSF
TPATGTPVVGGLTYREGLYITEEIYKTGLLSGLDIMEVNPSLGKTPEEVTRTVNTAVAIT
LACFGLAREGNHKPIDYLNPPK
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgagcgccaagtccagaaccatagggattattggagctcctttctcaaagggacagcca
cgaggaggggtggaagaaggccctacagtattgagaaaggctggtctgcttgagaaactt
aaagaacaagagtgtgatgtgaaggattatggggacctgccctttgctgacatccctaat
gacagtccctttcaaattgtgaagaatccaaggtctgtgggaaaagcaagcgagcagctg
gctggcaaggtggcagaagtcaagaagaacggaagaatcagcctggtgctgggcggagac
cacagtttggcaattggaagcatctctggccatgccagggtccaccctgatcttggagtc
atctgggtggatgctcacactgatatcaacactccactgacaaccacaagtggaaacttg
catggacaacctgtatctttcctcctgaaggaactaaaaggaaagattcccgatgtgcca
ggattctcctgggtgactccctgtatatctgccaaggatattgtgtatattggcttgaga
gacgtggaccctggggaacactacattttgaaaactctaggcattaaatacttttcaatg
actgaagtggacagactaggaattggcaaggtgatggaagaaacactcagctatctacta
ggaagaaagaaaaggccaattcatctaagttttgatgttgacggactggacccatctttc
acaccagctactggcacaccagtcgtgggaggtctgacatacagagaaggtctctacatc
acagaagaaatctacaaaacagggctactctcaggattagatataatggaagtgaaccca
tccctggggaagacaccagaagaagtaactcgaacagtgaacacagcagttgcaataacc
ttggcttgtttcggacttgctcgggagggtaatcacaagcctattgactaccttaaccca
cctaagtaa

KEGG   Homo sapiens (human): 384Help
Entry
384               CDS       T01001                                 

Gene name
ARG2
Definition
(RefSeq) arginase 2 (EC:3.5.3.1)
  KO
K01476  
arginase [EC:3.5.3.1]
Organism
hsa  Homo sapiens (human)
Pathway
Arginine biosynthesis
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of antibiotics
Biosynthesis of amino acids
Amoebiasis
Module
Urea cycle
Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    384 (ARG2)
  Amino acid metabolism
   00220 Arginine biosynthesis
    384 (ARG2)
   00330 Arginine and proline metabolism
    384 (ARG2)
 Human Diseases
  Infectious diseases
   05146 Amoebiasis
    384 (ARG2)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     384 (ARG2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
14q24.1
AA seq 354 aa AA seqDB search
MSLRGSLSRLLQTRVHSILKKSVHSVAVIGAPFSQGQKRKGVEHGPAAIREAGLMKRLSS
LGCHLKDFGDLSFTPVPKDDLYNNLIVNPRSVGLANQELAEVVSRAVSDGYSCVTLGGDH
SLAIGTISGHARHCPDLCVVWVDAHADINTPLTTSSGNLHGQPVSFLLRELQDKVPQLPG
FSWIKPCISSASIVYIGLRDVDPPEHFILKNYDIQYFSMRDIDRLGIQKVMERTFDLLIG
KRQRPIHLSFDIDAFDPTLAPATGTPVVGGLTYREGMYIAEEIHNTGLLSALDLVEVNPQ
LATSEEEAKTTANLAVDVIASSFGQTREGGHIVYDQLPTPSSPDESENQARVRI
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgtccctaaggggcagcctctcgcgtctcctccagacgcgagtgcattccatcctgaag
aaatccgtccactccgtggctgtgataggagccccgttctcacaagggcagaaaagaaaa
ggagtggagcatggtcccgctgccataagagaagctggcttgatgaaaaggctctccagt
ttgggctgccacctaaaagactttggagatttgagttttactccagtccccaaagatgat
ctctacaacaacctgatagtgaatccacgctcagtgggtcttgccaaccaggaactggct
gaggtggttagcagagctgtgtcagatggctacagctgtgtcacactgggaggagaccac
agcctggcaatcggtaccattagtggccatgcccgacactgcccagacctttgtgttgtc
tgggttgatgcccatgctgacatcaacacaccccttaccacttcatcaggaaatctccat
ggacagccagtttcatttctcctcagagaactacaggataaggtaccacaactcccagga
ttttcctggatcaaaccttgtatctcttctgcaagtattgtgtatattggtctgagagac
gtggaccctcctgaacattttattttaaagaactatgatatccagtatttttccatgaga
gatattgatcgacttggtatccagaaggtcatggaacgaacatttgatctgctgattggc
aagagacaaagaccaatccatttgagttttgatattgatgcatttgaccctacactggct
ccagccacaggaactcctgttgtcgggggactaacctatcgagaaggcatgtatattgct
gaggaaatacacaatacagggttgctatcagcactggatcttgttgaagtcaatcctcag
ttggccacctcagaggaagaggcgaagactacagctaacctggcagtagatgtgattgct
tcaagctttggtcagacaagagaaggagggcatattgtctatgaccaacttcctactccc
agttcaccagatgaatcagaaaatcaagcacgtgtgagaatttag

DBGET integrated database retrieval system