Hymenobacter jejuensis: FHG12_13115 Help Entry FHG12_13115       CDS       T06049                                  Symbol folB Name (GenBank) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism hyj  Hymenobacter jejuensis Pathway hyj00790   Folate biosynthesis hyj01100   Metabolic pathways hyj01240   Biosynthesis of cofactors Brite KEGG Orthology (KO) [BR:hyj00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     FHG12_13115 (folB) Enzymes [BR:hyj01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      FHG12_13115 (folB)  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      FHG12_13115 (folB)  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      FHG12_13115 (folB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB BMT5-like Motif Other DBs NCBI-ProteinID:  QDA62571 UniProt:  A0A5B8A5S5 LinkDB All DBs Position 3145482..3145847 Genome browser AA seq 121 aa AA seqDB search MGQIALEGMEFFAFHGYYDEEQKIGNKYGVDLYIETDLHAAGASDKLQATVNYEVLYKVV AEEMQAKARLLEHLGHRVIDRIFKEFPHVHSVRVSVSKFNPPLGGICHRARVTLERAQRK F NT seq 366 nt NT seq  +upstreamnt  +downstreamnt atcggccagattgcgctggagggaatggagttttttgccttccacggctactacgacgaa gagcagaaaatcggcaataagtacggcgtcgatctctacatcgaaaccgatctgcacgcc gccggtgcttccgataagctgcaagccaccgtgaactacgaagtgctttataaagtagtg gccgaagaaatgcaggccaaagcgcgcttgctcgagcacctcggccaccgcgtcatcgac cgcatttttaaagagtttccgcacgtgcactcggtgagagtgagcgtatcgaaattcaac ccgccgctgggcggcatttgccaccgggcccgcgtgacgctggagcgggcacagcgtaag ttttag

DBGET integrated database retrieval system