Leclercia adecarboxylata: APT61_14145 Help Entry APT61_14145       CDS       T04232                                  Name (GenBank) damage-inducible protein I   KO K12149   DNA-damage-inducible protein I Organism lax  Leclercia adecarboxylata Brite KEGG Orthology (KO) [BR:lax00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:lax03400]     APT61_14145 DNA repair and recombination proteins [BR:lax03400]  Prokaryotic type   TLS (translesion DNA synthesis) factors    Other SOS response factors     APT61_14145 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DinI Motif Other DBs NCBI-ProteinID:  ALZ97090 UniProt:  A0A3E1ZWL9 LinkDB All DBs Position 3027716..3027961 Genome browser AA seq 81 aa AA seqDB search MRIEVTIARTTALPAGALDALAGEFSRRINDSFPEREGAVTVRYAGSNNLSVIGGAKEDK ERISEILQETWESADDWFITD NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atgcgtatcgaagtcaccattgccagaacaactgctttgcctgctggtgcgctggacgcg ctggcgggtgaattttcccgccgtataaatgactcctttcccgaacgcgaaggtgctgtc accgtgcgttatgccgggtctaacaatctttcggttatcggtggtgccaaagaagataaa gaacgcatcagcgaaattttacaggaaacctgggaaagcgctgacgactggtttattacc gattaa

DBGET integrated database retrieval system