Lycium barbarum (goji berry): 132606646 Help Entry 132606646         CDS       T09483                                  Name (RefSeq) SKP1-like protein 1A   KO K03094   S-phase kinase-associated protein 1 Organism lbb  Lycium barbarum (goji berry) Pathway lbb03083   Polycomb repressive complex lbb04120   Ubiquitin mediated proteolysis lbb04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:lbb00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     132606646    04120 Ubiquitin mediated proteolysis     132606646   09126 Chromosome    03083 Polycomb repressive complex     132606646  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:lbb04131]     132606646    04121 Ubiquitin system [BR:lbb04121]     132606646    03036 Chromosome and associated proteins [BR:lbb03036]     132606646 Membrane trafficking [BR:lbb04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     132606646 Ubiquitin system [BR:lbb04121]  Ubiquitin ligases (E3)   Multi subunit Ring-finger type E3    SCF complex     Adaptor protein      132606646    Cul7 complex      132606646 Chromosome and associated proteins [BR:lbb03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      132606646   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      132606646 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Skp1 Skp1_POZ Motif Other DBs NCBI-GeneID:  132606646 NCBI-ProteinID:  XP_060176209 LinkDB All DBs Position 8:109683483..109686836 Genome browser AA seq 151 aa AA seqDB search MIVLKSSDGETFEVEEAVALESQTIKHMIEDDCANTSIPLPNVTSKILAKVIEYCKRHVE APKGDDNKVSDEDLKSFDADFVKVDQSTLFDLILAANYLNIKSLLDLTCQTVADMIKGKT PEEIRKTFNIKNDFTPEEEEEVRRENAWAFE NT seq 456 nt NT seq  +upstreamnt  +downstreamnt atgattgtattgaagagttccgatggagagacctttgaggttgaagaggcagtggcttta gagtcacagacaattaagcatatgattgaagatgactgtgctaacaccagcatccctttg cctaacgtcactagcaagatcttggctaaggttatcgagtactgcaagcgccacgtggag gctcctaagggcgatgataataaggtctctgatgaggatctcaagtcttttgatgctgat tttgtcaaagttgaccagagtacccttttcgatctcatactggctgccaactatttgaac ataaagagcctgcttgatctaacatgtcagacagttgcagacatgatcaaagggaagact cctgaggagatccgtaagacattcaacatcaagaatgatttcacccctgaggaggaggag gaagttaggagggagaacgcctgggcatttgagtga

DBGET integrated database retrieval system