Lemur catta (Ring-tailed lemur): 123630679 Help Entry 123630679         CDS       T08326                                  Symbol SOD1 Name (RefSeq) superoxide dismutase [Cu-Zn]   KO K04565   superoxide dismutase, Cu-Zn family [EC:1.15.1.1] Organism lcat  Lemur catta (Ring-tailed lemur) Pathway lcat04146   Peroxisome lcat04213   Longevity regulating pathway - multiple species lcat05012   Parkinson disease lcat05014   Amyotrophic lateral sclerosis lcat05016   Huntington disease lcat05020   Prion disease lcat05022   Pathways of neurodegeneration - multiple diseases lcat05208   Chemical carcinogenesis - reactive oxygen species Brite KEGG Orthology (KO) [BR:lcat00001]  09140 Cellular Processes   09141 Transport and catabolism    04146 Peroxisome     123630679 (SOD1)  09150 Organismal Systems   09149 Aging    04213 Longevity regulating pathway - multiple species     123630679 (SOD1)  09160 Human Diseases   09161 Cancer: overview    05208 Chemical carcinogenesis - reactive oxygen species     123630679 (SOD1)   09164 Neurodegenerative disease    05012 Parkinson disease     123630679 (SOD1)    05014 Amyotrophic lateral sclerosis     123630679 (SOD1)    05016 Huntington disease     123630679 (SOD1)    05020 Prion disease     123630679 (SOD1)    05022 Pathways of neurodegeneration - multiple diseases     123630679 (SOD1) Enzymes [BR:lcat01000]  1. Oxidoreductases   1.15  Acting on superoxide as acceptor    1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)     1.15.1.1  superoxide dismutase      123630679 (SOD1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Sod_Cu Motif Other DBs NCBI-GeneID:  123630679 NCBI-ProteinID:  XP_045396492 LinkDB All DBs Position 1:273932207..273939524 Genome browser AA seq 153 aa AA seqDB search MTLKAVCVLKGDGPVKGTIHFEQQENGPVVVKGRITGLTEGEHGFHVHQFGDNTQGCTSA GPHFNPQSKKHGGPKDQERHVGDLGNVTAGKDGEAVVSIEDSLISLSGEHSIIGRTMVVH EKPDDLGKGGNEESTKTGNAGSRLACGVIGIAQ NT seq 462 nt NT seq  +upstreamnt  +downstreamnt atgacgttgaaggctgtgtgcgtgttgaagggcgacggcccggtgaagggcaccatccac ttcgagcagcaggaaaatggaccagtggtggtaaagggacgcattacaggattgactgaa ggcgagcacggattccacgtccatcagtttggagataatacacaaggctgtaccagcgca ggtcctcactttaatcctcaatccaaaaaacatggtgggccaaaggatcaagagaggcat gttggagacctgggcaatgtgactgctggcaaagatggtgaggccgttgtgtctattgaa gactctttgatctcactctcgggcgaacattccatcattggccgcacaatggtggtccat gaaaaaccagatgacttgggcaaaggtggaaatgaagaaagtacaaagacgggaaatgct ggaagtcggctggcttgtggtgtaattgggatcgcccaataa

DBGET integrated database retrieval system