Lutra lutra (Eurasian river otter): 125087957 Help Entry 125087957         CDS       T08100                                  Name (RefSeq) C-C motif chemokine 4   KO K12964   C-C motif chemokine 4 Organism llv  Lutra lutra (Eurasian river otter) Pathway llv04060   Cytokine-cytokine receptor interaction llv04061   Viral protein interaction with cytokine and cytokine receptor llv04062   Chemokine signaling pathway llv04064   NF-kappa B signaling pathway llv04620   Toll-like receptor signaling pathway llv04623   Cytosolic DNA-sensing pathway llv05163   Human cytomegalovirus infection Brite KEGG Orthology (KO) [BR:llv00001]  09130 Environmental Information Processing   09132 Signal transduction    04064 NF-kappa B signaling pathway     125087957   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     125087957    04061 Viral protein interaction with cytokine and cytokine receptor     125087957  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     125087957    04623 Cytosolic DNA-sensing pathway     125087957    04062 Chemokine signaling pathway     125087957  09160 Human Diseases   09172 Infectious disease: viral    05163 Human cytomegalovirus infection     125087957  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:llv04052]     125087957 Cytokines and neuropeptides [BR:llv04052]  Cytokines   Chemokines    125087957 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 CXCL16 Motif Other DBs NCBI-GeneID:  125087957 NCBI-ProteinID:  XP_047564765 LinkDB All DBs Position 16:complement(37573902..37575747) Genome browser AA seq 92 aa AA seqDB search MKLCVTVLSLLVLVAAFSTPALSAPMGSDPPTACCFSYTLRKLPRNFVADYFETSSLCSQ PAVVFQTKRGRQVCANPSEAWVQEYMDDLELN NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atgaagctctgcgtgaccgtcctttctctccttgtgctcgtggctgccttctccactccg gctctctcagcaccaatgggctcagaccctcccaccgcctgctgcttctcttacacccta aggaagcttcctcgaaactttgtggccgattacttcgagaccagcagcctctgctcccag ccagctgtggtattccaaaccaaaagaggcagacaagtgtgtgctaaccccagcgaggcc tgggtccaggaatacatggacgatctggaactgaactga

DBGET integrated database retrieval system