Lepisosteus oculatus (spotted gar): 102682393 Help Entry 102682393         CDS       T07349                                  Symbol tmsb4x Name (RefSeq) thymosin beta-4   KO K05764   thymosin, beta 4 Organism loc  Lepisosteus oculatus (spotted gar) Pathway loc04810   Regulation of actin cytoskeleton Brite KEGG Orthology (KO) [BR:loc00001]  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     102682393 (tmsb4x)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:loc04812]     102682393 (tmsb4x) Cytoskeleton proteins [BR:loc04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Thymosin      102682393 (tmsb4x) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Thymosin DUF4522 Motif Other DBs NCBI-GeneID:  102682393 NCBI-ProteinID:  XP_006637965 Ensembl:  ENSLOCG00000010000 UniProt:  W5MV16 LinkDB All DBs Position LG14:21089445..21091011 Genome browser AA seq 44 aa AA seqDB search MSDKPNMEEVTSFDKTKLKKTETQEKNPLPSKETIEQEKQAESS NT seq 135 nt NT seq  +upstreamnt  +downstreamnt atgtctgacaaacccaacatggaagaggtcactagcttcgacaagaccaaactgaagaag acggagactcaagagaaaaaccctttgccgtcaaaagaaaccattgaacaggaaaagcaa gcagagtcatcgtga

DBGET integrated database retrieval system