Leptonychotes weddellii (Weddell seal): 102727401 Help Entry 102727401         CDS       T08708                                  Name (RefSeq) dynactin subunit 3-like   KO K10425   dynactin 3 Organism lww  Leptonychotes weddellii (Weddell seal) Pathway lww04814   Motor proteins lww05014   Amyotrophic lateral sclerosis lww05016   Huntington disease lww05022   Pathways of neurodegeneration - multiple diseases lww05132   Salmonella infection Brite KEGG Orthology (KO) [BR:lww00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     102727401  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     102727401   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     102727401    05016 Huntington disease     102727401    05022 Pathways of neurodegeneration - multiple diseases     102727401  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:lww03036]     102727401   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:lww04812]     102727401 Chromosome and associated proteins [BR:lww03036]  Eukaryotic type   Centrosome formation proteins    Microtubules and associated factors     Dynactin complex      102727401 Cytoskeleton proteins [BR:lww04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dynactins      102727401 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Dynactin_p22 Spidroin_MaSp RhoGEF67_u1 Motif Other DBs NCBI-GeneID:  102727401 NCBI-ProteinID:  XP_006752234 UniProt:  A0A2U3Z8D2 LinkDB All DBs Position Unknown AA seq 129 aa AA seqDB search LSHLPCQGLSPLHRSSSAQAYLTATVLSVFASEEQFILSQIALLEQVEALVPMLDSAHIK AVPEHAARLQRLAQIHIQQQDQCVEITEESKALLEEYNKTTMLLSKQFVQWDELLCQLEA AKQVKPAEE NT seq 392 nt NT seq  +upstreamnt  +downstreamnt gactcagccatctcccctgccagggcctcagccccttgcataggagtagcagtgcccagg cttacctcactgccactgtcttgtctgtttttgcctcagaggagcagtttatcttatccc agattgcactcctggagcaggtggaggctttggtgcccatgctggacagcgctcacatca aagctgttcctgagcatgctgcccgcctgcagcgcttggcccagatccacatccagcagc aggaccagtgtgtggagatcactgaggagtccaaggctctcctggaggaatacaacaaga ctacaatgcttctctccaagcaatttgtgcagtgggatgagctactttgccagctagagg ccgccaagcaagtgaagccagcagaggagtga

DBGET integrated database retrieval system